SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g061330.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g061330.1
Domain Number 1 Region: 11-102
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 4.12e-21
Family B3 DNA binding domain 0.0025
Further Details:      
 
Weak hits

Sequence:  Medtr3g061330.1
Domain Number - Region: 187-241
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0373
Family B3 DNA binding domain 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr3g061330.1
Sequence length 251
Comment | plant-specific B3-DNA-binding domain protein | LC | chr3:24357917-24359356 | 20130731
Sequence
marrnstlpirffkiilqtnlhriqipnkftrrygvhlsnpvlikppdgtkwkvywkkin
geiwfekgwkyftenyslghgslvvfeykrtskfdvhifgrnaveidysscdsddendnv
dhsdddesveildewlnwkkakqrspfvsprphkkvrgddekttkrtssinwpkdvraqk
vaqnfisnnpfftilikpnhiadsqlfvpldlkgiienkeknvllqigkkswnvkllrys
eilngrrlsag
Download sequence
Identical sequences G8A2Z6
Medtr3g061330.1 XP_003600451.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]