SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr3g452640.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr3g452640.1
Domain Number 1 Region: 217-330
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000706
Family B3 DNA binding domain 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr3g452640.1
Sequence length 336
Comment | DUF313 domain protein | LC | chr3:19271113-19270050 | 20130731
Sequence
MENTEAMTKEQKFAMTKEKINEYMEIAKTAPFNPHHNFAWQCVIATLAPQFYTQEELAQI
KKLYQRVLQETKERDHVRQETMEKDVVQEMMERDVLQETIEEDVLQKTMEGDVVQEKLEG
DVPQETIEEDVVQETMEGDVLQETMKEDVCQETMEEDVCQESRSMSHAERRVKPKSTKKM
KPKKQDKENLSSPPPILPIHIENKIKELNGTDIKYIMGKKLFASNLKDDQNRLLMSIKEV
KVDFLTDIEKDVSLTKKDENNKPVGLEVIVLDPSFREFTMSLRKWSMGINKYYSLVHGWK
TVVSKNSFEKGKKLNIWTFRVNDKLHFVLDNNQVML
Download sequence
Identical sequences A0A072V6I4
XP_013459744.1.50012 Medtr3g452640.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]