SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr4g068310.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g068310.1
Domain Number 1 Region: 5-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.26e-17
Family B3 DNA binding domain 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g068310.1
Sequence length 198
Comment | B3 DNA-binding domain protein | HC | chr4:25614411-25616733 | 20130731
Sequence
mdheqqdkpsffaiikegfntkcmkvppkivmdlgeefwkkasiilvcssgekwevkilk
kandiyvrnfgwqkflkdnsvgleeflvftyigenlfnveiygknglekpcfkkkqevva
apivakrkrgrprrnpagveeekeeaaptivaktkmvqrkypsrvcvrkekaetlativt
kkgiprknpaplsvilvd
Download sequence
Identical sequences G7JEY0
Medtr4g068310.1 XP_003606841.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]