SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr4g076030.2 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g076030.2
Domain Number 1 Region: 595-839
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000000425
Family Tropomyosin 0.0012
Further Details:      
 
Domain Number 2 Region: 429-596
Classification Level Classification E-value
Superfamily Tropomyosin 0.00000000371
Family Tropomyosin 0.00082
Further Details:      
 
Weak hits

Sequence:  Medtr4g076030.2
Domain Number - Region: 52-269
Classification Level Classification E-value
Superfamily Tropomyosin 0.0333
Family Tropomyosin 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr4g076030.2
Sequence length 1322
Comment | Uro-adherence factor A, putative | HC | chr4:29074837-29068419 | 20130731
Sequence
MEEETKAIPEVPVTKVVEEVVQKDESIKETNGDLLPREISEAKKDEEDNASDGEFIKVEK
EENVLDDASHKTERSSDPPSREFLEAQEKVRELEVELKTVAESLKTSEHENSQLKGEISD
TKEKLEETGKKYEDLELSHKKLQDQIIEAEKKYNLQLSTLEEALQSQEVKQKELLQVQEA
FGDMNVELESSRKKMQELQHELQLSTDEARKFEELHKQSGSHAESEGNKAVEFERLLEEA
KSSAKSMEDEMASLKEELKGVHDKIAENQKVEEALKTTAAELSAIQEELTLSKTQLLEVE
QRLSSRDSLVDELTEELNLRKTSETQIKEDMSALQNLICLYKGRATRKKFTELESAKVKL
QEEEKLRESVEVTFKSQEAQFVSVQEELTKLNAEKKGLEETVEDLTVNLSDESFSKTDSL
LSQALSNNSELEQKVKSLEDLHNESGAVAATASQRSLELEGHIEATNAAAEEAKSQLREL
ETRFIAAEQKNVELEQQLNLVQLKANDAERDVTEFSEKISHLDAKLKEAEEEKNLLNSLL
QEHMDKLSQLESDLNQSTQKNSQLEEELKIVKEKCSEHEDRATMNNERSRELEDLIQSSH
SKSESAEKRASELELLLETEKYRIQELEQQISALEKRCSDSEENSNKYLDNVSDLTSELE
SFKVRTSSLENTLQTANESEIELKESLNAVTDEKKKLEDALNSLSEKLAESENLLEIVRD
DLNLTQVKLQSTENDLKAAELRESEIREKHNAIEENLAVRGRDIELTSARNLELESLHES
LTRDSEQKLQEAIEKFNSKDSEVQSLLEKIKILEENIAGAGEQSISLKSEFEESLSKLAS
LQSENEDLKRQIVEAEKKTSQSFSENELLVGTNIQLKTKIDELQESLNSVVSEKEVTAQE
LVSHKNLLAELNDVQSKSSEIHSANEVRILEVESKLQEALQKHTEKESETKELNEKLNTL
EGQIKIYEEQAHEAVAAAENRKAELEESLIKLKHLEAAVEEQQNKSLERETETAGINEEK
LKLVQEIAVYESKLSDLQSKLSAALVEKDETVKEILASKNAAEDLVTQHNEEVQTLKSQI
SSVIDDRNLLNETNQNLKKELESIILDLEEKLKEHQKNEDSLKSEVETLKIEIAEKSALQ
SRLHEIEAQLAKAESRLHEEVGSVQAAASQREVAELEKELHLAQDTIANQKGEESQKLEL
EAALKNSVEELETKKNEISLLQKQVIEFEQKLQQADEKISVKGEEAVDKKDALEVKSRDF
SISSPSKRKSKKKSEATTPQTSTSSSETHIQPGHDSPIMNFKFILGVALVSIIFGVILGK
RY
Download sequence
Identical sequences G7JPM2
XP_003607292.1.50012 Medtr4g076030.1 Medtr4g076030.2

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]