SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr4g085790.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g085790.1
Domain Number 1 Region: 123-220
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000706
Family B3 DNA binding domain 0.0086
Further Details:      
 
Weak hits

Sequence:  Medtr4g085790.1
Domain Number - Region: 23-103
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000451
Family B3 DNA binding domain 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g085790.1
Sequence length 223
Comment | hypothetical protein | HC | chr4:33549895-33550810 | 20130731
Sequence
MANFITMYHNPPIDHFRAVKLSTQDHVEVQPEFVEKYKDDLQDPWNIMNMDGGMHQIKFK
MSLYNPTLKDGWEPLQQYHHFPNNVDIIFGYYGNNLFKVIMFREVFCATKIPSFHSRSMY
PEEVIIFDIHISDNDLNTPIKMLPNHFGTFLQNDFRSLLTLCCDDGTFYFVDIIHYGDYV
DDPNSGIQWNDFILSNYIVAGQKLRFKFDINTTYMCHVFPIDV
Download sequence
Identical sequences G7JL57
XP_003607947.1.50012 Medtr4g085790.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]