SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr4g119990.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr4g119990.1
Domain Number 1 Region: 212-312
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 2.94e-18
Family B3 DNA binding domain 0.0042
Further Details:      
 
Domain Number 2 Region: 11-106
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000000000000122
Family B3 DNA binding domain 0.0063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr4g119990.1
Sequence length 377
Comment | B3 DNA-binding domain protein | LC | chr4:49742159-49745391 | 20130731
Sequence
MSSTELDHRSNGVHFFKIILQRNLNEGKLKVPVSFVRRHWLGITNPVTLRLPNMTENKVF
WEKTSDYNVWFCNGWKEFAKYLSLGDSQLTLFQYQENSVFNVIVCGKCGLEIKYPLKETN
KEHEEVEESDTSLQIIEDPSSSKGKRLKSSPPYFKKMKINSKEQKEPKHEKRKVQEQGRF
LNFKDTDNGSSCDDLKERSKVLYDKVKNFFHADMDFFMCMIQKTYIKKDVLGIPIEFAKK
HLHRMEGRNITLFVDQDRPWNADLNLTLNNQYTLSGGWSKFRAHNNLKFGDICVFMLNKC
KGTVSFQVKIFSLEKDMSTPYFEVAWYLLGAEPTPASLGTSPGSAPTFFITSLGGWHRTT
LQRRKKIDWGGKCLGRK
Download sequence
Identical sequences G7JLI4
XP_003609682.1.50012 Medtr4g119990.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]