SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr5g007950.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g007950.1
Domain Number 1 Region: 151-265
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0000104
Family B3 DNA binding domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr5g007950.1
Sequence length 267
Comment | DUF313 domain protein | LC | chr5:1604377-1603574 | 20130731
Sequence
MEAMLEKKAAMARKKINALMQNMETMEERKFNPFPHFTLHNLLSYYAPQLYTEKDLAQIE
KINQHLRQETKLPLNIPQSTMKGEAVNKKKRCRSSDEGSMADKAKRRVKPKSTKKMVPKK
QDKEKLSSPPPILPIDVEIKIKELNGTDIKHIMCKELFDSDLSKHQSRLLMSLKEDIADD
FLNDTEKKTFGRKDRGTKSKLVGIEVIVLDPSFREFTMSLRKWGKSLYSLVQDWKHVMRQ
NSFEIGQKLNIWTFRVNSKLHFLLDKN
Download sequence
Identical sequences G7K6J2
Medtr5g007950.1 XP_003610872.1.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]