SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr5g046120.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g046120.1
Domain Number 1 Region: 78-124
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000051
Family B3 DNA binding domain 0.039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g046120.1
Sequence length 132
Comment | auxin response factor, putative | LC | chr5:20229310-20229708 | 20130731
Sequence
mlllpppmitftplilqrfrpftiriisavdllakphtdevfakllhtpitnnthvcvqd
phdvpncndhvrdeviglftrilaptnvsnrtfyiprscaenifpplgmeasqhlfiadv
hgedvsmtsgrg
Download sequence
Identical sequences G7JWX3
XP_003614195.1.50012 Medtr5g046120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]