SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr5g053510.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g053510.1
Domain Number 1 Region: 67-108
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000589
Family B3 DNA binding domain 0.0078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr5g053510.1
Sequence length 109
Comment | B3 DNA-binding domain protein | LC | chr5:22042709-22041847 | 20130731
Sequence
MAGYRVVLKRQILGGFETVHLPYQVLPPDFNDFLWDDDFDCLFLCNGNPNEGIVIAEIEY
QSNESLNTKLKNGWETFCNNNEFQLGDTIRFKFFDGKKSPFVHVYRNNP
Download sequence
Identical sequences G7JX45
XP_003614428.1.50012 Medtr5g053510.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]