SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr5g074840.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr5g074840.1
Domain Number 1 Region: 58-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000405
Family B3 DNA binding domain 0.0093
Further Details:      
 
Weak hits

Sequence:  Medtr5g074840.1
Domain Number - Region: 12-34
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.0471
Family B3 DNA binding domain 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr5g074840.1
Sequence length 163
Comment | auxin response factor 14 | HC | chr5:31785822-31784688 | 20130731
Sequence
MRLQQEQKEAYLPAELGTPSKQPTNYFCKTLTASQVTQALTGDCLCLVGRLKKCFLLRHL
LTTGWSVFVSAKILVAGDSVMFTWNEKNQLLFGIRHAIWPQTVMPSSVLSTDSLHLGLLA
AVAHAAATNSPFTIFYNPRACPSEFVIPSLSIMLEYVKVVYHA
Download sequence
Identical sequences G7KFL5
Medtr5g074840.1 XP_003615988.2.50012

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]