SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr6g004120.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr6g004120.1
Domain Number 1 Region: 23-125
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.000000000000124
Family B3 DNA binding domain 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Medtr6g004120.1
Sequence length 139
Comment | E1 protein | LC | chr6:126677-127096 | 20130731
Sequence
MAYRNNRVCDHLTLGVCHCTSNDDSWNIKKVLKQTDVGYCSRLLLGKKLAEEFVLPVLGA
KAHRGIQVKIWDIDTKSMHTIKFKRRSGMYFFNGGWVKEFVIRRGLQEGNKIGLYWDQYG
KFFNFTVLEADKDQNRHYV
Download sequence
Identical sequences A0A072UG20
XP_013450702.1.50012 Medtr6g004120.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]