SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr7g098870.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr7g098870.1
Domain Number 1 Region: 156-269
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 0.00000000804
Family B3 DNA binding domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Medtr7g098870.1
Sequence length 271
Comment | DUF313 domain protein | LC | chr7:39616550-39615735 | 20130731
Sequence
mtkeqryaitrekikgymekaktaplnlshnfawqcviairapqfyseeeltqikkhsql
vlqetrkipqntvegevantkkrcrpcdevsmsyaerrtkpkttkkvepkkrtkpkttrk
vpkkqdkknlalpppilpinvknkikelngtdiryimskklfasdidegqsrllmplked
elgfltkteketldekdendkpvglevivldpyfrsftmcfkkwkmtnkwvysliqnwkh
avrgngfeigqilnvwsfrvkdklqfvlnin
Download sequence
Identical sequences G7KYG9
XP_003625412.1.50012 Medtr7g098870.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]