SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for Medtr8g079492.1 from Medicago truncatula

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  Medtr8g079492.1
Domain Number 1 Region: 111-255
Classification Level Classification E-value
Superfamily DNA-binding pseudobarrel domain 7.72e-47
Family B3 DNA binding domain 0.0055
Further Details:      
 
Domain Number 2 Region: 777-856
Classification Level Classification E-value
Superfamily CAD & PB1 domains 0.00000209
Family PB1 domain 0.044
Further Details:      
 
Weak hits

Sequence:  Medtr8g079492.1
Domain Number - Region: 502-563
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0398
Family BAR domain 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Medtr8g079492.1
Sequence length 914
Comment | auxin response factor 2 | HC | chr8:34084967-34077764 | 20130731
Sequence
MKLSSAGFSPPPQEGEKRVLDSELWHACAGPLVCLPADGSRVVYFPQGHSEQVAVSTNRE
VDTYIPNPSLPPQLICQLHNLTMHADTETDEVYAQMTLQPLNPEEQKEAYLPAELGTANK
QPTNYFCKILTASDTSTHGGFSVPRRAAEKVFPPLDFTQQPPAQELIARDLHGNDWKFKH
IFRGQPKRHLLTTGWSVFVSAKRLVAGDSVLFIWNEKNQLLLGIRRASRPQHMMPSSVLS
SDSMHLGLLAAAAHAAATNSRFTIFYNPRASPSEFVIPLAKYVKAVYHTRVSVGMRFRML
FETEESSVRRYMGTITGISDLDSVRWPNSHWRSVKVGWDESTAGERQPRVSLWEIEPLTT
FPMYPSPFPLRLKRPWPPGLPSFHGLKDDDFGMNSPLLWLRDADRGLQTLNFQGMGVNPW
MQARLDPSMMNMQPDMYQAMAAAALQDMRTLDPSKQHPASLLQFQQPQNFSNGNAALMQN
QMLQQSQPHQAFPKNQESQHPSQSQAQTQQFQQLLQHQHSFTNQNYHMQQQQQQQQQQQQ
QQQQQHQQQQQQQSQQQQQVVDHQQMSNAVSTMSQFVSAPPSQSTQPMQAISSIGHQQNF
SDSNGNPVSPLHNMLGSFSNDETSHLLNFPRPNSWVPVQSSTARPSKRVAVDPLLSSGAS
HYVLPQVEQLGQSQTTMSQNAITLPPFPGRECAIEGNTDPQNHLLFGFNIEPSSHLVYNE
MSNLKRVNSNCDSSTAPFQSSTYLNTTGADSSLNPGLTHGVGESGFMQTPENGGQGNPQN
KTFVKVYKSGSFGRSLDITKFSNYPELRSELARMFGLEGELEDPVRSGWQLVFVDQENDV
LLLGDGPWPEFVNSVWCIKILSPQEVQQMGTNGLELLNSAPTQRLSNGICDDYTGREDSR
NLSTGLTTVGSLDY
Download sequence
Identical sequences A0A072U3V8
XP_013446498.1.50012 Medtr8g079492.1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]