SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for gi|530316039|ref|YP_008402003.1| from Corynebacterium glutamicum MB001

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|530316039|ref|YP_008402003.1|
Domain Number 1 Region: 38-124
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 0.00000000000793
Family Phosphate binding protein-like 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|530316039|ref|YP_008402003.1|
Sequence length 156
Comment ABC-type putative amino acid transporter, substrate-binding lipoprotein [Corynebacterium glutamicum MB001]
Sequence
MNKSSFRRAFYIIICSISLYSCASFPVDSEGTLDRARGDELVVGISENKPWTQTSGTGRY
SGIEVDLIEGFADTIDADVQWLHAPESVLAEKIKNGQLDLMIGGLSSSSPWSSHMALSRP
YHQFDGEEKVMGVRLGENDLMMALERYLAHEFGEIR
Download sequence
Identical sequences A0A2H5IAC9 Q8NNQ6
NP_601333.2.3765 WP_011014903.1.21641 WP_011014903.1.3871 WP_011014903.1.4395 WP_011014903.1.80527 gi|62390968|ref|YP_226370.1| 196627.cg2340 gi|62390968|ref|YP_226370.1| gi|62390968|ref|YP_226370.1| gi|530316039|ref|YP_008402003.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]