SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|31544807|ref|NP_853385.1| from Mycoplasma gallisepticum str. R(low)

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|31544807|ref|NP_853385.1|
Domain Number 1 Region: 5-223
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 2.93e-50
Family Extended AAA-ATPase domain 0.00000885
Further Details:      
 
Domain Number 2 Region: 236-304
Classification Level Classification E-value
Superfamily "Winged helix" DNA-binding domain 0.0000000000163
Family Helicase DNA-binding domain 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|31544807|ref|NP_853385.1|
Sequence length 306
Comment Holliday junction ATP-dependent DNA helicase RuvB [Mycoplasma gallisepticum str. R(low)]
Sequence
MKLARPNNFDEFIGKNELKQKLLTFINASISQNKALDHVLFYGPPGVGKTSLAQIIANEL
KSKIKILQASQIQKPADLLNAFSLLSKNDVLFIDEIHSLSPTIMELLFPIMEDYVVDILI
GKEFNSKFTRMKLPPFTLIGATTMYGRIIDPLEERFGILLQLDYYQDDEIFEIIRSINAK
EKIKLTKDEMVQIAEHSKGTPRNALRIYKRVMDFKLFDQEITIKSILEKLNIYQYGLSNL
DLEYLKSFDDNPKLYLGLKSLSLISGIDCFTIESKIEPYLLKMNLIKKTSKGRQITQKAI
QYFKDN
Download sequence
Identical sequences Q7NAN3
WP_011113862.1.10884 WP_011113862.1.30373 WP_011113862.1.56312 233150.MGA_0404 gi|31544807|ref|NP_853385.1| gi|385325725|ref|YP_005880163.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]