SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21226140|ref|NP_632062.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21226140|ref|NP_632062.1|
Domain Number 1 Region: 128-397
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 4.6e-102
Family BC ATP-binding domain-like 0.000000153
Further Details:      
 
Domain Number 2 Region: 667-927
Classification Level Classification E-value
Superfamily Glutathione synthetase ATP-binding domain-like 5.3e-102
Family BC ATP-binding domain-like 0.000000268
Further Details:      
 
Domain Number 3 Region: 543-669
Classification Level Classification E-value
Superfamily PreATP-grasp domain 2.73e-47
Family BC N-terminal domain-like 0.00000898
Further Details:      
 
Domain Number 4 Region: 393-540
Classification Level Classification E-value
Superfamily Carbamoyl phosphate synthetase, large subunit connection domain 7.45e-47
Family Carbamoyl phosphate synthetase, large subunit connection domain 0.0001
Further Details:      
 
Domain Number 5 Region: 1-127
Classification Level Classification E-value
Superfamily PreATP-grasp domain 1.09e-46
Family BC N-terminal domain-like 0.00000564
Further Details:      
 
Domain Number 6 Region: 932-1067
Classification Level Classification E-value
Superfamily Methylglyoxal synthase-like 2.35e-35
Family Carbamoyl phosphate synthetase, large subunit allosteric, C-terminal domain 0.0012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21226140|ref|NP_632062.1|
Sequence length 1073
Comment carbamoyl phosphate synthase large subunit [Methanosarcina mazei Go1]
Sequence
MPKREDIKKVLLIGSGPITIGQAAEFDFSGSQACRSLKEEGVQVVLVNSNPATIMTDPEM
ADSVYIEPLDARIIEKIIEKERPDGIIAGIGGQTGLNITSELAEMGVFEKYGVQILGTPV
EAIKNTEDRELFKETMLSIGEKVPLSRAVHSLKEAEEVVEELGLPLIIRPAYTLGGAGGG
IARTKEELLEITERGLRRSRINQVLIEESVLGWAEVEYEVMRDANDTCIVICNMENIDPM
GVHTGESAVVAPSQTLSDEEHQMLRSASIKIIRALKIEGGCNIQYALKEGDYRIVEVNPR
VSRSSALASKATGYPIARVTAKIAIGMTLDEIVNSVTKSTPASFEPALDYVITKIPRWPF
DKFTTADKTLTTAMKSTGEIMAIGRTIEESLLKAFKSLDIDNQLGIKRWDEPEIKTLLKT
PTSERLFVIFHALERGMSIKEIAELTSINPFFISKMKKIVEMEKCIRTEELTPEFLREVK
RMGFPDSRLAELTGKTREQISDFRHEEGILATFKMVDTCAAEFEAATPYYYSTYEDTCET
NSTDKKKILILGAGPIRIGQGIEFDYCTVHAVTALREEGIETHIINNNPETVSTDFDTSD
KLFFEPLTMEYVMNVIERERPDGVLVQFGGQTSVNLALPLKKELKRRTDLNTVILGTDPE
DMDLAEDREKFYLLMQELGIPQPEGGYATSQQEAIEVAKRIGFPVLVRPSYVLGGRAMEI
VYDEIDLERYMKEAVRVSPEHPILIDDFLEAACEIDVDAVCDQIDVLIGAIMEHIEEAGV
HSGDSACVIPPQSLSKEVLDQVRDYTRKIALGLRVKGLINIQMAEKGGKVFVLEANPRSS
RTIPFVSKAVGIPLAKIAAKVIAGHSLKDLGYTDEPKPKHVSIKEVLLPFDKLPGADPVL
GPEMKSTGEVMGVDYDFGRAYYKAELAADNLLPLTGKVFLSIRNADKPELVEAARKLQAA
GLELMGTRGTVNYLAQHGIFMDTVKKVHDGSPNVIDMMRRDEVDLIINTPTSKMSRKDGY
RIRRAAVDFKVPYITTIQAAVAAADAIETMKKGQDLTIKSINEYHKEMEQKEE
Download sequence
Identical sequences A0A0E3RRG3 P58944
WP_011031992.1.49674 WP_011031992.1.82674 192952.MM_0038 gi|21226140|ref|NP_632062.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]