SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21226524|ref|NP_632446.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21226524|ref|NP_632446.1|
Domain Number 1 Region: 7-137
Classification Level Classification E-value
Superfamily Transposase IS200-like 7.06e-36
Family Transposase IS200-like 0.00024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21226524|ref|NP_632446.1|
Sequence length 137
Comment transposase [Methanosarcina mazei Go1]
Sequence
MYFLVNMKYETRNHRKFLLMYHVIFVCKYRKVILEPISEELKQIMIDISKESNFEILEME
TDKDHIHFLIKSEPKVSVLSIVRKLKQESTNRLWKTQKDYLEKYYWGENTLWSDGYFAST
IGNVSKEAAEYYIRNQG
Download sequence
Identical sequences Q8PZS0
WP_011032375.1.12270 WP_011032375.1.13133 WP_011032375.1.13782 WP_011032375.1.14209 WP_011032375.1.14583 WP_011032375.1.14776 WP_011032375.1.15587 WP_011032375.1.16483 WP_011032375.1.16878 WP_011032375.1.18729 WP_011032375.1.18783 WP_011032375.1.21267 WP_011032375.1.21501 WP_011032375.1.2157 WP_011032375.1.21629 WP_011032375.1.21918 WP_011032375.1.24179 WP_011032375.1.29103 WP_011032375.1.29761 WP_011032375.1.32345 WP_011032375.1.33522 WP_011032375.1.40449 WP_011032375.1.41322 WP_011032375.1.43564 WP_011032375.1.43834 WP_011032375.1.44090 WP_011032375.1.4739 WP_011032375.1.49674 WP_011032375.1.4970 WP_011032375.1.53089 WP_011032375.1.53770 WP_011032375.1.57580 WP_011032375.1.58691 WP_011032375.1.61041 WP_011032375.1.61670 WP_011032375.1.62876 WP_011032375.1.63409 WP_011032375.1.64722 WP_011032375.1.65224 WP_011032375.1.66913 WP_011032375.1.7135 WP_011032375.1.7314 WP_011032375.1.73216 WP_011032375.1.73711 WP_011032375.1.74065 WP_011032375.1.75484 WP_011032375.1.75785 WP_011032375.1.76299 WP_011032375.1.7642 WP_011032375.1.76508 WP_011032375.1.8229 WP_011032375.1.82623 WP_011032375.1.83034 WP_011032375.1.8430 WP_011032375.1.84394 WP_011032375.1.90340 WP_011032375.1.9066 WP_011032375.1.90871 WP_011032375.1.91617 WP_011032375.1.94933 WP_011032375.1.95514 gi|21226524|ref|NP_632446.1| 192952.MM_0422

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]