SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21227043|ref|NP_632965.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227043|ref|NP_632965.1|
Domain Number 1 Region: 10-441
Classification Level Classification E-value
Superfamily L-aspartase-like 2.36e-124
Family L-aspartase/fumarase 0.0000000558
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21227043|ref|NP_632965.1|
Sequence length 452
Comment adenylosuccinate lyase [Methanosarcina mazei Go1]
Sequence
MVIDMAIHPIEYRYGTAEMKYVWSQENRLAKILQTEAALARAEADMGLIPAEAAEIIFES
IASVKAERVDEIESEIHHDMMAVVVAISEMCRDDAGKWVHFGATSNDILDTATALQIKDA
IDILEDKLKTLLKVLVNQAEAHKNTVCCGRTHGQIGVPTTYGLRFAIWASEISRHLDRLY
ELTPRATVGQMTGAVGTQAAFGKSGILIQKLTMQHLGIGAVDVSNQIIQRDRHAEFVMWM
ANVVTTLDKIGIEIRTLQRSEIAEIEESFGKKQVGSSTMPHKRNPIKSEQICGLARIVRA
MVEPELLNNTLWDERDLTNSSSERIVFPEACILTDHIIKLGISVLENLRFYPENIRRNLD
SLNGLNMGEAVMIELAKRGVGRQEAHELVRTAAMRAHDTGQHFKQVLLDTPSVSKYLSAG
DIENLVNPDKYIGTAVEQVEGLVIKLREAYSL
Download sequence
Identical sequences Q8PYC2
192952.MM_0941 gi|21227043|ref|NP_632965.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]