SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21227482|ref|NP_633404.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227482|ref|NP_633404.1|
Domain Number 1 Region: 149-336
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 1.8e-60
Family Actin/HSP70 0.0000031
Further Details:      
 
Domain Number 2 Region: 4-143
Classification Level Classification E-value
Superfamily Actin-like ATPase domain 3.63e-44
Family Actin/HSP70 0.0000231
Further Details:      
 
Domain Number 3 Region: 349-470
Classification Level Classification E-value
Superfamily Heat shock protein 70kD (HSP70), peptide-binding domain 4.97e-40
Family Heat shock protein 70kD (HSP70), peptide-binding domain 0.0000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21227482|ref|NP_633404.1|
Sequence length 473
Comment chaperone protein [Methanosarcina mazei Go1]
Sequence
MAIIELGEPKVITNSEGKRLTPSVVGFSKKNELLVGDLAKRQMVSNPENTVHSIKRHMGK
PDYRVTLNNEKFTPHGISAKILQKLKHDAEKYLGDAVEKAVITVPAYFNDSQRFATKKAG
ELAGLEVLRVINEPTAAALAYGLRDGINNRKIMVYDFGGGTFDVSILKIKDGIFEVLATS
GDTELGGDDFDMRIVEHLLARFQEAEGKNLSDIPQAMQRIREAAERCKIDLSTLETANVN
LPYIFENKNLDIDITREQFNKMTEDFVKKTISIIEKTLQDARLSPSEIDEVIFVGGSTRI
PAVVKAVEGFMGKKALQNINPDEVVAMGASVQAGILGNDYLKSPREEVDSGNLVLLDVTS
LTLGFETVGDLMAPIIPKNTTIPTRNSKTFTTHYDNQRVVRGKILQGEERAASKNVTLGT
LVLDNIPPSPKGIPRIEVTFDIDANGIINATAKDLGTGIMRSVTIERPQGLND
Download sequence
Identical sequences A0A0E3Q1G5 A0A0E3RFW5 A0A0E3RVQ4 A0A0E3RZW7 M1QIK9 Q8PX42
gi|21227482|ref|NP_633404.1| 192952.MM_1380 gi|452209962|ref|YP_007490076.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]