SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21227855|ref|NP_633777.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227855|ref|NP_633777.1|
Domain Number 1 Region: 115-296
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.16e-58
Family Formate/glycerate dehydrogenases, NAD-domain 0.0000108
Further Details:      
 
Domain Number 2 Region: 18-150
Classification Level Classification E-value
Superfamily Formate/glycerate dehydrogenase catalytic domain-like 1e-39
Family Formate/glycerate dehydrogenases, substrate-binding domain 0.00023
Further Details:      
 
Domain Number 3 Region: 333-462
Classification Level Classification E-value
Superfamily Serine metabolism enzymes domain 3.4e-35
Family SerA intervening domain-like 0.00074
Further Details:      
 
Domain Number 4 Region: 460-537
Classification Level Classification E-value
Superfamily ACT-like 0.0000000000000186
Family Phosphoglycerate dehydrogenase, regulatory (C-terminal) domain 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227855|ref|NP_633777.1|
Sequence length 540
Comment D-3-phosphoglycerate dehydrogenase [Methanosarcina mazei Go1]
Sequence
MLKFSISCLSYLSGEIDMKVLVSDSLSNEGLEILKEHFDIDVCTGLCEDELVEKIKGYDA
LVIRSGTQVTQRIIEAADNLKIIGRAGVGVDNVDVDAATKKGIIVANAPEGNMISAAEHT
IAMMMSMSRNIPQANASLKAREWKRNKFMGVEVKGKTLGVIGLGRIGSEVAKRAAGLEMN
LMGYDPFISEKRAMELGVKLATVNEIAKEADYITVHTPLIKETRNILDDEQFALMKKGVR
VLNCARGGIINEEALARALESGKVGGAAIDVFVEEPPFSSPLLNFDNVIVTPHLGASTQE
AQVNVAIDIAKEVVSVLTGGSAKNAINIPSVKPEAMAVLAPYIRLSELMGKIAGQLVDSN
YEKVEIAYNGEISGKDTRPLTVSALKGLLEMAVGSGVNYVNAPILAKSRKIAVVESKSES
AEEYSSTVSIRLSSGESTKMVAGTVVGDEPKIVSIDDDKVDIFPAGRMIFAKHINKPNVI
GPCCMVLGKNNINISGMQVGRSEVGGVTMMVLNVDTDVSDAILDEVRQVPGILNAKLVTL
Download sequence
Identical sequences Q8PW48
gi|21227855|ref|NP_633777.1| 192952.MM_1753

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]