SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21227986|ref|NP_633908.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21227986|ref|NP_633908.1|
Domain Number 1 Region: 1-129
Classification Level Classification E-value
Superfamily Transposase IS200-like 1.23e-39
Family Transposase IS200-like 0.00023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|21227986|ref|NP_633908.1|
Sequence length 154
Comment transposase [Methanosarcina mazei Go1]
Sequence
MELHSFSHGYGQITYHIVLVPKYRYSIFYNKRIKKDCELIFSNICTKNGYKIHAMEVVDN
HVHLFLEFHPSNSLSEVIQYLKGGSSYRLFKLHPDLKKQYWGGSLWSNGKFYRSVGNVTA
DTIKHYIKESQGKPSEESQLYRFMRSEQRKLDDF
Download sequence
Identical sequences Q8PRP9
WP_011032309.1.13782 WP_011032309.1.18729 WP_011032309.1.23878 WP_011032309.1.49674 WP_011032309.1.64722 WP_011032309.1.82674 WP_011032309.1.90340 192952.MM_0355 192952.MM_1884 192952.MM_2304 192952.MM_2439 192952.MM_2799 192952.MM_2906 gi|21226457|ref|NP_632379.1| gi|21227986|ref|NP_633908.1| gi|21228406|ref|NP_634328.1| gi|21228541|ref|NP_634463.1| gi|21228901|ref|NP_634823.1| gi|21229008|ref|NP_634930.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]