SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21228160|ref|NP_634082.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21228160|ref|NP_634082.1|
Domain Number 1 Region: 23-171
Classification Level Classification E-value
Superfamily YutG-like 3.27e-34
Family YutG-like 0.00098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21228160|ref|NP_634082.1|
Sequence length 180
Comment hypothetical protein MM_2058 [Methanosarcina mazei Go1]
Sequence
MKLSDIEERDLKKGQPENIEEKATIDILDVLAEEGISVQDLADTALEMYVPHPGLETREK
AEALFKRELKFALSDPNLCLLIYTGVLLEREGKAGNLPNLSKKSYEKDLTFIIADEVLGT
SIATYISGSKGAFEFVRYDKQKPGILANLGPFMDDVIGGLIGGVSSNMYSRGMAEFERKD
Download sequence
Identical sequences A0A0E3Q0L5 A0A0E3RZY4 A0A0F8JJQ5 M1QB93 Q8PVB3
gi|452210611|ref|YP_007490725.1| 192952.MM_2058 WP_011033990.1.12270 WP_011033990.1.13133 WP_011033990.1.14209 WP_011033990.1.14583 WP_011033990.1.14776 WP_011033990.1.15587 WP_011033990.1.16483 WP_011033990.1.16878 WP_011033990.1.18729 WP_011033990.1.18783 WP_011033990.1.21267 WP_011033990.1.21501 WP_011033990.1.2157 WP_011033990.1.21629 WP_011033990.1.21918 WP_011033990.1.23878 WP_011033990.1.24179 WP_011033990.1.29103 WP_011033990.1.29761 WP_011033990.1.32345 WP_011033990.1.33522 WP_011033990.1.40449 WP_011033990.1.41322 WP_011033990.1.43564 WP_011033990.1.43834 WP_011033990.1.44090 WP_011033990.1.4739 WP_011033990.1.49674 WP_011033990.1.4970 WP_011033990.1.53089 WP_011033990.1.53770 WP_011033990.1.57580 WP_011033990.1.58691 WP_011033990.1.61041 WP_011033990.1.61670 WP_011033990.1.62876 WP_011033990.1.63409 WP_011033990.1.64722 WP_011033990.1.65224 WP_011033990.1.66913 WP_011033990.1.7135 WP_011033990.1.7314 WP_011033990.1.73216 WP_011033990.1.73711 WP_011033990.1.74065 WP_011033990.1.75484 WP_011033990.1.75785 WP_011033990.1.76299 WP_011033990.1.7642 WP_011033990.1.76508 WP_011033990.1.8229 WP_011033990.1.82623 WP_011033990.1.83034 WP_011033990.1.8430 WP_011033990.1.84394 WP_011033990.1.9066 WP_011033990.1.91617 WP_011033990.1.94933 WP_011033990.1.95514 gi|21228160|ref|NP_634082.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]