SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21228409|ref|NP_634331.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21228409|ref|NP_634331.1|
Domain Number 1 Region: 8-460
Classification Level Classification E-value
Superfamily L-aspartase-like 3.14e-123
Family L-aspartase/fumarase 0.000000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21228409|ref|NP_634331.1|
Sequence length 491
Comment argininosuccinate lyase [Methanosarcina mazei Go1]
Sequence
MSNILRRGRLEAAQDEEILRYTSSMEADRWIFNADIVVDLAHTVMLREQGIIKEEDCSKI
LSGLLKIREEGMEKLDFSYEDIHISLESRLIDMVGEDVGGRMHSGRSRNDEVATCIRLTL
REELLGLLEEIFALRKTLVSLAEKHSETLMPGFTHLQHAQPTTLAHHLCAHESALGRDFD
RVQDAFSRVNLCPLGAAAFASTGFNLNRKRTQELLGFEGLLENSMDAVSSRDFLIECASV
FSNLMINLSRIAEELVIWSSSEFNFIELDDMYASTSSIMPQKKNPDTAELMRGKTGVSVG
ALMSLLTICKGLPLSYNRDLQEATPNIWRSVETVRASVRVMEGMVKTMKVHPDVLAAESI
TGFTTATELADTFVRETGIPFRTAHQIVGMLAKEREKPTMEKIDSASEVVLGESLSSKGL
TENMVKEALNPESNIKRRKIPGGPAPEEMKNYLSKRKTELELNAQEIATLKDIIDSAFEN
LLSVVEEYRKI
Download sequence
Identical sequences A0A0E3RH38 Q8PUM6
gi|21228409|ref|NP_634331.1| 192952.MM_2307 WP_011034231.1.49674 WP_011034231.1.90340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]