SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21229164|ref|NP_635086.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21229164|ref|NP_635086.1|
Domain Number 1 Region: 56-167
Classification Level Classification E-value
Superfamily Hedgehog/DD-peptidase 2.86e-21
Family Muramoyl-pentapeptide carboxypeptidase 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|21229164|ref|NP_635086.1|
Sequence length 351
Comment hypothetical protein MM_3062 [Methanosarcina mazei Go1]
Sequence
MSGTTGSEKTITFPSGSTFRVVDTPQDGIDYSDPVGNGTVPLIEVRDRMQENISKNFKVK
ELAATDGARYARISPELVAGLQRIRDRVGSAVVLNSGYRHNVLNETVGGADESQHITGRA
ADIRASAKSPLDLARIALEELGCDIGIGLGRNSIHVDLRGQLTSWRYEGAELSENEFDQW
VRDTCQQLGRRHSERAEYSERVLPKIIGPEVYVATDEAPAFYIEIGPNSYYAVEIATHTD
LFSSQYEAERNPGNFYSSLEREGLIEAHGAATTYTLPKEVWERLRGEKRLYYRIATSAMP
GSNMLYSTTDQQAANAPWIEITGGRQEREEFAVSPLDLQATRKADENLWRK
Download sequence
Identical sequences A0A0E3RFB2 Q8PSL7
192952.MM_3062 gi|21229164|ref|NP_635086.1| WP_011034960.1.49674 WP_011034960.1.90340

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]