SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21229287|ref|NP_635209.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21229287|ref|NP_635209.1|
Domain Number 1 Region: 30-276
Classification Level Classification E-value
Superfamily PLP-binding barrel 4.91e-64
Family Alanine racemase-like, N-terminal domain 0.0000357
Further Details:      
 
Domain Number 2 Region: 249-390
Classification Level Classification E-value
Superfamily Alanine racemase C-terminal domain-like 1.76e-27
Family Eukaryotic ODC-like 0.0027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21229287|ref|NP_635209.1|
Sequence length 390
Comment ornithine decarboxylase [Methanosarcina mazei Go1]
Sequence
MRKEPYDFPLDDYISREEFNKIKKFSRDKETPFLIVDLQKIERSYDELVEHMPFAKIHYA
VKANPLDKVVLALKRKGSNFDVATIYELDQLIRLGVEPERISYGNTIKKEKDIAYAYDNG
VRLFVTDSESDLKKLARRAPGSRVFFRILTESDGADWPLSRKFGSHPDLIYKLILKAEKL
GLEPYGLSFHVGSQQRDIGQWDNAIAKCKYLFEAVAEKGIHLKMINLGGGFPAKYQSQAH
DLETYAHEIRRFLHEDFGEELPEILIEPGRSLVADAGIIVSEVIMIAKKARFNQYKWVYL
DIGKFGGLIETLDECIKYPIFCDKKGCAEEVILAGPTCDSMDILYEHHKYSFPHTMRDGN
RVYIFTTGAYTQSYSSICFNGFPPLKAYVI
Download sequence
Identical sequences A0A0E3LU59 A0A0E3R825 A0A0E3RPH0 A0A0E3S2A1 A0A0F8PTK0 Q8PS97
NYSGRC-FDAO-21229287 WP_011035080.1.13133 WP_011035080.1.13782 WP_011035080.1.14209 WP_011035080.1.14583 WP_011035080.1.14776 WP_011035080.1.15587 WP_011035080.1.16483 WP_011035080.1.16878 WP_011035080.1.18729 WP_011035080.1.18783 WP_011035080.1.21267 WP_011035080.1.21501 WP_011035080.1.2157 WP_011035080.1.21918 WP_011035080.1.24179 WP_011035080.1.29103 WP_011035080.1.29761 WP_011035080.1.32345 WP_011035080.1.33522 WP_011035080.1.40449 WP_011035080.1.41322 WP_011035080.1.43564 WP_011035080.1.43834 WP_011035080.1.44090 WP_011035080.1.4739 WP_011035080.1.49674 WP_011035080.1.4970 WP_011035080.1.53089 WP_011035080.1.53770 WP_011035080.1.57580 WP_011035080.1.58691 WP_011035080.1.61041 WP_011035080.1.62876 WP_011035080.1.63409 WP_011035080.1.65224 WP_011035080.1.66913 WP_011035080.1.7135 WP_011035080.1.7314 WP_011035080.1.73216 WP_011035080.1.74065 WP_011035080.1.75484 WP_011035080.1.75785 WP_011035080.1.7642 WP_011035080.1.76508 WP_011035080.1.8229 WP_011035080.1.82623 WP_011035080.1.82674 WP_011035080.1.83034 WP_011035080.1.8430 WP_011035080.1.90340 WP_011035080.1.9066 WP_011035080.1.90871 WP_011035080.1.91617 WP_011035080.1.94933 WP_011035080.1.95514 gi|21229287|ref|NP_635209.1| 192952.MM_3185

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]