SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|21229324|ref|NP_635246.1| from Methanosarcina mazei Go1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|21229324|ref|NP_635246.1|
Domain Number 1 Region: 1-119
Classification Level Classification E-value
Superfamily SpoIIaa-like 1.29e-33
Family Sfri0576-like 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|21229324|ref|NP_635246.1|
Sequence length 120
Comment hypothetical protein MM_3222 [Methanosarcina mazei Go1]
Sequence
MIELIPGFPENVVAVTASGVLTGEDYEKVLVPAIEEKVKKYGKIRLLYQLNERFEGFTDK
AMFEDATIGIRHITDFERIAVISDVEWIINAVKIFEFIIPGSVRVYRNKEFPEAKAWISE
Download sequence
Identical sequences A0A0E3PVE4 A0A0E3R7Y8 A0A0E3REV2 A0A0E3RPJ7 A0A0E3S276 A0A0F8PHH0 M1Q8A7 Q8PS60
gi|21229324|ref|NP_635246.1| gi|452211733|ref|YP_007491847.1| 192952.MM_3222 WP_011035117.1.12270 WP_011035117.1.13133 WP_011035117.1.13782 WP_011035117.1.14209 WP_011035117.1.14583 WP_011035117.1.14776 WP_011035117.1.15587 WP_011035117.1.16483 WP_011035117.1.16878 WP_011035117.1.18729 WP_011035117.1.18783 WP_011035117.1.21267 WP_011035117.1.21501 WP_011035117.1.2157 WP_011035117.1.21629 WP_011035117.1.21918 WP_011035117.1.23878 WP_011035117.1.24179 WP_011035117.1.29103 WP_011035117.1.29761 WP_011035117.1.32345 WP_011035117.1.33522 WP_011035117.1.40449 WP_011035117.1.41322 WP_011035117.1.43564 WP_011035117.1.43834 WP_011035117.1.44090 WP_011035117.1.4739 WP_011035117.1.49674 WP_011035117.1.4970 WP_011035117.1.53089 WP_011035117.1.53770 WP_011035117.1.57580 WP_011035117.1.58691 WP_011035117.1.61041 WP_011035117.1.61670 WP_011035117.1.62876 WP_011035117.1.63409 WP_011035117.1.64722 WP_011035117.1.65224 WP_011035117.1.66913 WP_011035117.1.7135 WP_011035117.1.7314 WP_011035117.1.73216 WP_011035117.1.73711 WP_011035117.1.74065 WP_011035117.1.75484 WP_011035117.1.75785 WP_011035117.1.76299 WP_011035117.1.7642 WP_011035117.1.76508 WP_011035117.1.8229 WP_011035117.1.82623 WP_011035117.1.82674 WP_011035117.1.83034 WP_011035117.1.8430 WP_011035117.1.84394 WP_011035117.1.90340 WP_011035117.1.9066 WP_011035117.1.90871 WP_011035117.1.91617 WP_011035117.1.94933 WP_011035117.1.95514

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]