SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000002746 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000002746
Domain Number 1 Region: 450-584,611-749
Classification Level Classification E-value
Superfamily Ankyrin repeat 9.44e-68
Family Ankyrin repeat 0.00014
Further Details:      
 
Domain Number 2 Region: 143-433
Classification Level Classification E-value
Superfamily Ankyrin repeat 4.98e-66
Family Ankyrin repeat 0.0000126
Further Details:      
 
Domain Number 3 Region: 1065-1268
Classification Level Classification E-value
Superfamily ADP-ribosylation 6.81e-39
Family Poly(ADP-ribose) polymerase, C-terminal domain 0.0019
Further Details:      
 
Domain Number 4 Region: 759-906
Classification Level Classification E-value
Superfamily Ankyrin repeat 5.64e-37
Family Ankyrin repeat 0.0001
Further Details:      
 
Domain Number 5 Region: 986-1047
Classification Level Classification E-value
Superfamily SAM/Pointed domain 0.00000000000000314
Family SAM (sterile alpha motif) domain 0.012
Further Details:      
 
Weak hits

Sequence:  ENSACAP00000002746
Domain Number - Region: 122-134
Classification Level Classification E-value
Superfamily Formin homology 2 domain (FH2 domain) 0.000602
Family Formin homology 2 domain (FH2 domain) 0.13
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000002746   Gene: ENSACAG00000002619   Transcript: ENSACAT00000002815
Sequence length 1286
Comment pep:novel scaffold:AnoCar2.0:GL343257.1:1326196:1409725:1 gene:ENSACAG00000002619 transcript:ENSACAT00000002815 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASSSRRSQQQQHHHQAQAPLSPPRSPSLSPQQQQRPSLSGPEGEATSSSGREGSAAAAER
PFSPESVGEASGPPAPPGSGASSVATSSTSSSSSTSGSSSSSSSAASSPAAAESPDPPAP
PPPPPPPLQPPPPPVGSGAFRELLEACRNGDVTRVRRLVDAANVNAKDMAGRKSTPLHFA
AGFGRKDVVEHLLQTGANVHARDDGGLIPLHNACSFGHAEVVSLLLCQGADPNARDNWNY
TPLHEAAIKGKIDVCIVLLQHGADPNIRNTDGKSALDLADPSAKAVLTGEYKKDELLEAA
RSGNEEKLMALLTPLNVNCHASDGRKSTPLHLAAGYNRVRIVQLLLQHGADVHAKDKGGL
VPLHNACSYGHYEVTELLLKHGACVNAMDLWQFTPLHEAASKNRVEVCSLLLSHGADPTL
VNCHGKSAVDMAPTPELKERLTYEFKGHSLLQAAREADLAKVKKTLALEVINFKQPQSHE
TALHCAVASLHPKRKQVTELLLRKGANVNEKNKDFMTPLHVAAERAHNDVMEVLHKHGAK
MNALDTLGQTALHRAALGGHLQTCRLLLNYGSDPSIISLQGFTAAQMGNEAVQQILNENT
PVHTSDVDYRLLEASKAGDLETVKQLCSPQNVNCRDLEGRHSTPLHFAAGYNRVSVVEYL
LHHGADVHAKDKGGLVPLHNACSYGHYEVAELLVRHGASVNVADLWKFTPLHEAAAKGKY
EICKLLLKHGADPTKKNRDGNTPLDLVKEGDTDIQDLLRGDAALLDAAKKGCLARVQKLC
SPENINCRDTQGRNSTPLHLADVAGYNNLEVAEYLLEHGADVNAQDKGGLIPLHNAASYG
HVDIAALLIKYNTCVNATDKWAFTPLHEAAQKGRTQLCALLLAHGADPTMKNQEGQTPLD
LATADDIRALLIDAMPPDALPTCFKPQATVVSASVISPASTPSCLSAASSIDNLAGPLAE
IAVGGASNAGDGAAGTERKEGEVVGLDMNISQFLKSLGLEHLRDIFETEQITLDVLADMG
HEELKEIGINAYGHRHKLIKGVERLLGGQQGTNPYLTFHCVSQGTILIDLAPDDKEYQSV
EEEMQSTIREHRDGGNAGGIFNRYNVIRIQKVVNKKLRERFCHRQKEVSEENHNHHNERM
LFHGSPFINAIIHKGFDERHAYIGGMFGAGIYFAENSSKSNQYVYGIGGGTGCPTHKDRS
CYICHRQMLFCRVTLGKSFLQFSTMKMAHAPPGHHSVIGRPSVNGLAYAEYVIYRGEQAY
PEYLITYQIVKPDTPSQTATAAEQKT
Download sequence
Identical sequences H9G6R5
ENSACAP00000002746 ENSACAP00000002746

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]