SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000001743 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000001743
Domain Number 1 Region: 1142-1281,1342-1408
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.09e-36
Family Hemopexin-like domain 0.001
Further Details:      
 
Domain Number 2 Region: 26-66
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.000000000902
Family Somatomedin B domain 0.0011
Further Details:      
 
Domain Number 3 Region: 67-109
Classification Level Classification E-value
Superfamily Somatomedin B domain 0.00000000248
Family Somatomedin B domain 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000001743   Gene: ENSACAG00000001824   Transcript: ENSACAT00000001783
Sequence length 1408
Comment pep:novel scaffold:AnoCar2.0:GL343203.1:2499731:2541851:-1 gene:ENSACAG00000001824 transcript:ENSACAT00000001783 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWNIYCTSLLFLTVFLAQQVSSQDVSSCEGRCGEGYNRQHGCQCDSNCLLYAECCPDYQ
TICVEDLSCKGRCTAHFVRGKPCDCDPDCNTFGKCCPDFEEACPPIVQIQNPSTTTTVLP
ISTTTKPPTTTPKIKSTTKRSPKLNSKPKPKPKPKPKPKPKPKPLKKKKKQKKSSMSSSS
SSKIRRTMASVTNTGDKPKKKNGKNARESKSKLKSSKSKAVKVISEEDGSGVENALTTAG
TTTSTARQSSTASTTRVPSTTTTTTEVPSTTTKTTTEVPSTTTTTTTKLPPTTTTTSITT
TTVKQPTTTMPTTQLTPTTTTTTNLPPTTLIYTKTPTPQTEKVTTSLRSATPKPLNLLSS
TASIINKQLTLSTVATIRANKDTDSAVQKTTISPAKDTMTISKRDTTTATSEAVEDINNA
NNQAVTTVGKSEATNERVTTTANKDYIATDIKERITNEDIYSTPATLFTNTPQTEEHRHT
TPQTDPNDTSPSTVYKSDQPEETTTITETTITQTDPNDTSPSTVDKSDQPEETTTITETT
ITQTDPNDTSPSTVDKSDQPEETTTITETTITQTDPNDTSPSTVDKSDQPEETTTVTETT
ITQTDPNDTSPSTVDKSDQPEETTTVTETTITQTDPNDTSPSTVDKSDQPEKTTTITETT
ITQTDPNDTSPSTVDKSDKPEGITTVTETTITQTDPNDTTTPSSVDKTDYPDKSVPVTII
TDSSSEPPTPLNDDKSITETSLAESTPSPASDDKNNTPEITTTVSKMIITEDPYPEVVTP
NPDAETTNDKPTPSLDDRNNNPEVTSTVTETIVTESDPLSPIGISENVPSTGKPELPEEI
TQTEPPNDEPNPNTDENGERPKDITKIIETTTITNSPQSTPNPGEQDNPTKVTETTTAIT
TESKPLSDSPNSDASDRPDSITTVTKTTTTTTTESSPSTDDSDKNDNPEVITKITRTVTT
ITTTTTTTTQSNTTEHPETITQNVTTNTKIDLVSDREPTKENPTTKNTDTTVKEETIISS
IISKPVNTPPFVEDQTTGQTSPSPTARIPTRRRQVTYYPNLNHTQHIASGDLRTKSSNQV
EGTRCIEEGGKDKDGGSWEGSLDHLGLNRHMLLKKALSDEVYFCKNDNMANYFAPDIPDE
MNLCNRKAADGIVPLRNGSLAVFRGHYYWLLNGTTPPTPSPRRITEVWGIPSPIDTVFSR
CNCDGKTFFFKDSQYWRFTNDVMDVGYPKLIIKGFGGLSGRITGALSVANHKNRPESVYF
FKKVNLGGNLQQYTYKQEGPKKCKKKIVSVKYPIYKPKPVIRRRRRFERAVRPHFIRSVR
VQHYPVVQINTQPTGILQPEVKVTTYWRGFPKEVNSVISIPNYQKPDGYDYYAFSKDQYY
SVDVGSRIARPVTLQTGQTVSNAWYKCP
Download sequence
Identical sequences ENSACAP00000001743

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]