SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004540 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004540
Domain Number 1 Region: 628-883
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-55
Family YWTD domain 0.00000321
Further Details:      
 
Domain Number 2 Region: 17-276
Classification Level Classification E-value
Superfamily YWTD domain 4.32e-55
Family YWTD domain 0.00000142
Further Details:      
 
Domain Number 3 Region: 327-562
Classification Level Classification E-value
Superfamily YWTD domain 3.27e-50
Family YWTD domain 0.00000326
Further Details:      
 
Domain Number 4 Region: 931-1191
Classification Level Classification E-value
Superfamily YWTD domain 3.79e-39
Family YWTD domain 0.0000341
Further Details:      
 
Domain Number 5 Region: 885-933
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000335
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 1323-1361
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000196
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1243-1284
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000314
Family LDL receptor-like module 0.001
Further Details:      
 
Domain Number 8 Region: 1285-1320
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000615
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 9 Region: 583-630
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000617
Family EGF-type module 0.0086
Further Details:      
 
Domain Number 10 Region: 279-321
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000179
Family EGF-type module 0.0094
Further Details:      
 
Domain Number 11 Region: 1200-1254
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000305
Family EGF-type module 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004540   Gene: ENSACAG00000004466   Transcript: ENSACAT00000004645
Sequence length 1611
Comment pep:novel chromosome:AnoCar2.0:5:83078166:83141666:1 gene:ENSACAG00000004466 transcript:ENSACAT00000004645 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ICAQPTSMILSSFQASPLLLYANRRDLRLVDAAQVNENATVVVSGLEDAAAVDFIFIHGL
IYWSDVSEEAIKRTEFNKTGNVQNVVISGLLSPDGLACDWLGEKLYWTDSETNRIEVSNL
DGSLRKVLFWQELDQPRAIALDPARGFMYWTDWGEVPKIERAGMDGSTRSIIITADIYWP
NGLTLDYEDQKLYWADAKLNFIHRSNLDGTHREAVIKGSLPHPFALTLFGDTLYWTDWTT
RAVLACNKYTGENLREIHSNIFSPMDIHVFNQQRQPNATNPCGTNNGGCSHLCLMSPVKP
SYQCACPTGVKLLENEKTCKDGAMELLLLARRTDLRRISLDTPDFTDIVLQLEDIRHAIA
IDYDPVEGYIYWTDDEVRAIRRSFIDGSASQFVVQAQIAHPDGIAVDWIARNLYWTDTGT
DRIEVTRLNGTMRKILISEELEEPRAIVLDPMVGYMYWTDWGEIPKIERATLDGSDRVVL
VNTSLGWPNGLALDYVEHKIYWGDAKTDKIEVMNADGTNRRVLVEDKLPHIFGFTLLGDY
IYWTDWQRRSIERVHKRTAEREIIIDQLPDLMGLKATNVHQITGTNPCAELNGGCSHLCL
YRPQGLRCACPIGLELINDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTGVKEA
SALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLYWADT
GTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDGSERS
TLVPNVGRANGLTIDYVKRRLYWTDLDTNLIESSNMLGLDRDVIADDLPHPFGLTQYQDY
IYWTDWSRRSIERANKTSGQNRTIIQNHLDYVMDILVFHSSRQAGWNECASSNGHCSHLC
LAVPVGGFVCGCPAHYSLNSDNKTCSAPTSFLLFSQKNAINRMVIDELQSPDIILPIHSL
RNVRAIDYDPLDKQLYWIDSRQNVIRRSQEDGSQSFTVVMSPVPNQNLDIQPYDLSIDIY
SRYIYWTCEANNVINVTRLDGRPMGVVLKSDQDRPRAIVVNPEKGYMYFTNLQERSPPKI
ERAALDGTEREVLFSNGLSKPVALAVDSQLGKLFWADSDLRRIESSDLSGANRIVLEDSN
ILQPIGLTVFENWLYWIDRHQQMIEKIDMTRQDRRTKVQARIAQLSDIHAVKELNMQEYK
LHPCSQDNGGCSHICIVKGDGTTRCSCPIHLVLLQDELSCGAEPPTCSPQHFTCFTGEID
CIPVAWRCDGFTECEDASDEKNCPVCSESQFQCDSGQCIDSALQCNGEPNCQDSSDEKKC
EVLCLTDQFRCSSGQCIGKNKKCDQNLDCSDNSDEQGCYTTEEPAPQASSTIGSVVGVIL
TLFVVTAMYFVCQRVLCPRMKGEGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMPRG
KSVISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPPILNPPPSPATERSHYTMEF
GYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRVMTTTVGKGYTSDLNY
DSEPVPPPPTPRSQYLSAEENYESCPPSPFTERSYSHHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSACAP00000004540

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]