SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000004827 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000004827
Domain Number 1 Region: 372-588
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 6.46e-47
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.001
Further Details:      
 
Domain Number 2 Region: 307-379
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000412
Family Domains B1 and B5 of PheRS-beta, PheT 0.013
Further Details:      
 
Domain Number 3 Region: 5-85
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.0000000226
Family Domains B1 and B5 of PheRS-beta, PheT 0.0091
Further Details:      
 
Domain Number 4 Region: 218-283
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.00000023
Family B3/B4 domain of PheRS, PheT 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000004827   Gene: ENSACAG00000004769   Transcript: ENSACAT00000004935
Sequence length 589
Comment pep:novel chromosome:AnoCar2.0:3:25517865:25559251:1 gene:ENSACAG00000004769 transcript:ENSACAT00000004935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTVSVKRELLFQALGRSYTDEEFDELCFEFGLELDEITSEKEIISKEKGDGKAEGASDV
ILFKIDVPANRYDLLCLEGLVRGLQVFKERIRAPRYKKITPPSGEIQKLVITEETVQVRP
YAVAAVLRNITFDKDRYDSFIDLQEKLHQNICRKRSLVAIGTHDLDTVCGPFTYTAKPPS
EIKFKPLNQDKEYTAAELMDLYRTDSHLRHYLHIIENEPQYPVIYDSNGVVLSMPPIING
DHSKISLNTKNVLIECTATDLTKAKIVLDILVAMFSEYCQKTFTAEAAEVLYPNGKSHIF
PELPYRREKIKPEIMNKKIGICETPSNLAKLLTRMCLKSHVIGNGNNIEVEIPPTRPDII
HACDIIEDAAIAYGYNNIQMTIPKTYTIANQLPLNKLTELLRQDLAAAGFTEALTFALCS
QEDIANKLGIDISATKAVHIANPKTAEFQVARTTLLPGILKTVAANRKMPLPLKLFEISD
IVVKDSTKDVGARNHRHLCAIYYNKNPGFEIIHGLLDRIMQLLDVSPSKENGYYIKASED
PAFFPGRCAEIFAKGRSIGNLGVLHPDVITKFELTMPCSVLEITIEPFV
Download sequence
Identical sequences 28377.ENSACAP00000004827 ENSACAP00000004827

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]