SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000005344 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000005344
Domain Number 1 Region: 299-495
Classification Level Classification E-value
Superfamily Hemopexin-like domain 3.4e-70
Family Hemopexin-like domain 0.00000551
Further Details:      
 
Domain Number 2 Region: 87-253
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.49e-56
Family Matrix metalloproteases, catalytic domain 0.000000109
Further Details:      
 
Domain Number 3 Region: 4-70
Classification Level Classification E-value
Superfamily PGBD-like 2.35e-20
Family MMP N-terminal domain 0.0044
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000005344   Gene: ENSACAG00000005407   Transcript: ENSACAT00000005461
Sequence length 571
Comment pep:novel chromosome:AnoCar2.0:4:133950951:133978852:1 gene:ENSACAG00000005407 transcript:ENSACAT00000005461 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SSKYSNAQNWLKTYGYLLSSDTRMSALHSGKVMQSAVTTMQRFYGIPVTGVLDQTTIAWM
KKPRCGVPDHPHLSHRRRSKRYALTGQKWRQKHITYSVHNYTPKVGELDTRKAIRQAFDV
WQRVTPLTFEEVPYHEIKSDRKEADIMIFFASGFHGDSSPFDGEGGFLAHAYFPGPGIGG
DTHFDSDEPWTLGNSNHDGNDLFLVAVHELGHALGLEHSNDPSAIMAPFYQYMETHNFKL
PQDDLQGIQKIYGPPAEPLEPTRPLPTLPVRRIHSTSERKHDRHSRPPRPPLGDRPSSPG
SKPNICDGNFNTVALFRGEMFVFKDRWFWRLRNNRVQEGYPMQIEQFWKGLPAKIDAAYE
RSDGKFVFFKGDKYWVFKEVTAEPGYPHSLVELGSCLPREGIDTALRWEPVGKTYFFKGD
RYWRYNEDKRATDPGYPKPITVWKGIPQAPQGAFVSKEGFYTYFYKGKEYWKFDNQRLTV
EPGYPRSILKDWMGCNQKEVERSKDRRLSHDDVDIMVTINDVPSTVNAIAVVIPCILSLC
ILVLVYTIFQFKNKEVQQSVTYYRRPVQEWV
Download sequence
Identical sequences ENSACAP00000005344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]