SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000007183 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000007183
Domain Number 1 Region: 280-476
Classification Level Classification E-value
Superfamily Hemopexin-like domain 8.11e-68
Family Hemopexin-like domain 0.00000541
Further Details:      
 
Domain Number 2 Region: 78-241
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 4.02e-42
Family Matrix metalloproteases, catalytic domain 0.0000516
Further Details:      
 
Domain Number 3 Region: 1-62
Classification Level Classification E-value
Superfamily PGBD-like 1.73e-16
Family MMP N-terminal domain 0.0064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000007183   Gene: ENSACAG00000007313   Transcript: ENSACAT00000007338
Sequence length 536
Comment pep:novel scaffold:AnoCar2.0:GL343364.1:84687:96763:1 gene:ENSACAG00000007313 transcript:ENSACAT00000007338 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DWLTRFGYLLPPDPNTGQLQTQEELAKAIMTMQQFGGLEATGILDEATLKLMKTPRCSLP
DLLQSEARTLRHTPAVTKWNKRNLSWRVRTFPKESHLGHDTVRALMYYALKVWSDITPLN
FHEVAGNNADIQIDFSKTDHNDGYPFDGPGGMVAHAFSPGEHHAAGDTHFDDDESWTFRS
SDAHGMDLFAVAVHEFGHAIGLTHVSAIESIMRPYYQGPVGDPLKYDLPYEDKVRIWQLY
GVRESVSLTAKPEISKTNDQPVLLDLPENRSTNPLRRDAPNRCNTHFDAVAQIRGEAFFF
KGKYFWRLTRNKHLVSLQPAQIHRFWRGLPLNLDSVDAVYERIHDHKIVFFKGDKYWVFK
DNNVEEGYPRLISDFGLPLGGIDAAFSWALDDKTYFFKDHLYWCYNEYERRMEPGYPLET
TLWQGIPNRLDDATRWSDGATYFFKGKEYWKVMDSNLEAEPGYPQSIARDWLVCSDMQAD
APAPAESTRTRQHAKHDESHSKIEVCSCTSSSPNPFWPHSLQRLIINLLLASFWTV
Download sequence
Identical sequences H9GCK2
ENSACAP00000007183 ENSACAP00000007183

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]