SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000010029 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000010029
Domain Number 1 Region: 335-531
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.06e-69
Family Hemopexin-like domain 0.0000104
Further Details:      
 
Domain Number 2 Region: 117-292
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 2.67e-55
Family Matrix metalloproteases, catalytic domain 0.0000000626
Further Details:      
 
Domain Number 3 Region: 37-104
Classification Level Classification E-value
Superfamily PGBD-like 7.69e-18
Family MMP N-terminal domain 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000010029   Gene: ENSACAG00000010198   Transcript: ENSACAT00000010236
Sequence length 606
Comment pep:novel chromosome:AnoCar2.0:4:22127069:22227899:1 gene:ENSACAG00000010198 transcript:ENSACAT00000010236 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LVVLTSRLCFLFLSVCLAEESLLFLPFIDAVYQQGHFIEVWLQKYGYLPPTDPRMSVLRT
AETMKSAIAAMQQFYGINMTGKVDRNTIEISSWMKKPRCGVPDQTRGNSRFNIRRKRYAL
TGQKWQHKHITYSIKNVTPKVGDAETRKAIRRAFDVWQNVTPLTFEEVPYIELENGKRDV
DITIIFASGFHGDSSPFDGEGGFLAHAYFPGPGIGGDTHFDSDEPWTLGNPNHDGNDLFL
VAVHELGHALGLEHSNDPTAIMAPFYQYMETDNFKLPNDDLQGIQKIYGPPDKISPPTKP
LPTVPPHRSVPPVDPRKNDRPKPPRQPPGDKPPYPGAKPNICDGNFNTLAILRREMFVFK
DQWFWRVRNNRVMDGYPMQITYFWRGLPPSIDAVYENSDGNFVFFKGNKFWVFKDTTLQP
GYPHDLITLGNGIPPHGIDSAIWWEDVGKTYFFKGDRYWRYSEDIRTMDAGYPKPITIWK
GVPESPQGAFIHKENGFTYFYKGKEYWKFNNQMLRVEPGYPRSILKDFMGCDGPADRDKD
RHSPQDDVDIVIKLDNTASTVKAIAIVIPCILALCLLVLVYTVFQFKRKGTPRHILYCKR
SMQEWV
Download sequence
Identical sequences ENSACAP00000010029

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]