SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000011523 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000011523
Domain Number 1 Region: 649-747
Classification Level Classification E-value
Superfamily Fibronectin type III 1.29e-17
Family Fibronectin type III 0.00074
Further Details:      
 
Domain Number 2 Region: 87-174
Classification Level Classification E-value
Superfamily Fibronectin type III 0.000000000157
Family Fibronectin type III 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000011523   Gene: ENSACAG00000011687   Transcript: ENSACAT00000011763
Sequence length 892
Comment pep:novel chromosome:AnoCar2.0:3:173938052:174073307:1 gene:ENSACAG00000011687 transcript:ENSACAT00000011763 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KRQSLKVQINVTSDGVCMRYIRPSTSTKLEGFILGYGSSFFSNQYISLPADGKSYMTEVD
AEPRYLISVRPMPVTNYKKSCSGKTHTPKPLQLVIGTLTPTSVFLSWGILVNPKHDWTTM
NNCANDRFYTVRYREKDKNKKWALQLCPTTETVVDNLKPNAVYEFGVKDNTDNGIWSKIF
NHKVVMPSKNKENGQPQNKIDPISGIPTPRNSKVLHPVTIIKQVLQNVTQQTKTKIPEKS
PLAGPILVHLIVPDFNGTQQKLLSPFTLDVPEKPKKTPASHEIESVSSESQTPVPKGTWT
KQAVTNEPTPESLTPKSAKPLDWPKSTLAPPETAFIPFKRKPSDTPEGRQVKPAPNLPPL
KHNTPKTSRILEKTTTTPGAPVETNFIPSIPKPSTRPKMPDVKYVCGTVIKKSSELFPPE
APKVKEHIYSPKTTMTPHPLHTKPAKPKTTDKTRSRPVVNKTTPVPGRTRTPGGVAWNKL
SRGITLSRKKPDPGKNSRIRTSSHGGKEAGGQSGKPTPPGPPRSPLASAKPTPVRRKPLP
PNTVTGKPGRSGIISTKRVTTSSPIKPAGPTGLAKTSSHKKPPTAASSPDYIGCNPMFSS
LPTTETDVAGTPRYTGDHVKYMKKEEDVPCSITDTLQHFPTEDGENIDTATTPPRKPPTN
LTVVTVEGCPSFVILDWEKPQNETVTEYKVVSTENGSSDVRDTSIITTNQTHSTVENLKP
NTSYAFQVIPSNPLGEGPSSESMPFKTESADPRVTEPISMGKDAIWTEIKFNSDTYSECK
GKQYVKRTWYKKFVGVQLCNSLRYKIYLSDTLTGKFYNIGDQRGYGEDHCQFVDSYLDGR
TGQQIPSDQLSTKDGFFRAVRQEPVHFGRIGAETHTNYVHWYECGTTIPGKW
Download sequence
Identical sequences G1KLG6
ENSACAP00000011523 ENSACAP00000011523

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]