SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000013468 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000013468
Domain Number 1 Region: 76-152
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.22e-64
Family Ubiquitin-related 0.0094
Further Details:      
 
Domain Number 2 Region: 152-228
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.33e-64
Family Ubiquitin-related 0.0094
Further Details:      
 
Domain Number 3 Region: 228-304
Classification Level Classification E-value
Superfamily Ubiquitin-like 1.33e-64
Family Ubiquitin-related 0.0094
Further Details:      
 
Domain Number 4 Region: 1-76
Classification Level Classification E-value
Superfamily Ubiquitin-like 5.21e-64
Family Ubiquitin-related 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000013468   Gene: ENSACAG00000013749   Transcript: ENSACAT00000013746
Sequence length 304
Comment pep:novel contig::AAWZ02039315:4814:5725:-1 gene:ENSACAG00000013749 transcript:ENSACAT00000013746 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN
IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI
FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA
KIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
ITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLR
LRGG
Download sequence
Identical sequences C1L939 H9GK63
5b83_A 5b83_D ENSACAP00000013468 ENSACAP00000013468

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]