SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000014430 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000014430
Domain Number 1 Region: 3-263
Classification Level Classification E-value
Superfamily YWTD domain 8.76e-55
Family YWTD domain 0.00000215
Further Details:      
 
Domain Number 2 Region: 615-870
Classification Level Classification E-value
Superfamily YWTD domain 3.92e-54
Family YWTD domain 0.00000555
Further Details:      
 
Domain Number 3 Region: 314-544
Classification Level Classification E-value
Superfamily YWTD domain 2.49e-49
Family YWTD domain 0.00000237
Further Details:      
 
Domain Number 4 Region: 917-1176
Classification Level Classification E-value
Superfamily YWTD domain 9.55e-40
Family YWTD domain 0.000046
Further Details:      
 
Domain Number 5 Region: 873-919
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000639
Family EGF-type module 0.043
Further Details:      
 
Domain Number 6 Region: 1269-1304
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000707
Family LDL receptor-like module 0.0011
Further Details:      
 
Domain Number 7 Region: 1228-1268
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.000000000969
Family LDL receptor-like module 0.00096
Further Details:      
 
Domain Number 8 Region: 1307-1345
Classification Level Classification E-value
Superfamily LDL receptor-like module 0.00000000157
Family LDL receptor-like module 0.0015
Further Details:      
 
Domain Number 9 Region: 570-616
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000142
Family EGF-type module 0.013
Further Details:      
 
Domain Number 10 Region: 268-311
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000387
Family EGF-type module 0.013
Further Details:      
 
Domain Number 11 Region: 1186-1238
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000148
Family EGF-type module 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000014430   Gene: ENSACAG00000014411   Transcript: ENSACAT00000014725
Sequence length 1587
Comment pep:novel chromosome:AnoCar2.0:1:75433537:75528312:1 gene:ENSACAG00000014411 transcript:ENSACAT00000014725 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ASPLLLFANRRDVRLVDAGGVKAESTIVVSGLEDAAAVDFLYSQSVIYWTDVSEEAIKQT
YFNQTGNLVQNVIVSGLVSPDGLACDWIGKKLYWTDSETNRIEVANLNGTSRKVLFWQDL
DQPRAIALDPAHGYMYWTDWGETPRIERAGMDSSVRKIIVDSDIYWPNGLTIDLEEQKLY
WADAKLSFIHRANLDGSFREKVVEGSLTHPFALTLAGDTLYWTDWQTRSIHACNKRTGEK
RREILSSLYSPMDIQVLSSERQPYFHTPCEDNNGGCSHLCLLSPRDPFYSCNCPTGVQLQ
EDGKTCKAGAEEVLLLARRTDLRRISLDMPDFTDIILQIDNIRHAIAIDYDPVDGYIYWT
DDDIRAIRRAFLDGTGAQTIVSTEIDHPDGIAVDWVARNLYWTDTGTDRIEVTRLNGTSR
KILISENLDEPRAIVLNPVMGYMYWTDWGENPKIECAYLDGSERKVLVNTSLGWPNGLAL
DLEESKLYWGDAKIDKIEVINLDGTMRKTLIEDKLPHIFGFTLLGDYIYWTDWQRRSIER
VHKIRASRDIIIDQLPDLMGLKAASVTKAVGTNPCAENNGGCSHLCFFTPQECRCACPIG
LELLSDMKTCIIPEAFLVFTSRAAIHRISLETNNNDVAIPLTGVKEASALDFDVSDNRIY
WTDISLKTISRAFMNGSTVEHVIEFGLDYPEGMAVDWMGKNLYWADTGTNRIEVARLDGL
YRQVLVWKDLDNPRSLALDPSKGYMYWTEWGGKPKIIRAYMDGSNSITLVDKVGRANDLT
IDYEDQRLYWTDLDTSMIVSSNMLGQEREIIADDLPHPFGLTQYSDFIYWTDWNLHSIER
ADKINGRNRTLIQGRLDFVMDILVFHSSRQDGFNECVQSNGHCGQLCLAIPNGYTCGCAS
HYTLEPNGRNCSSPSSFLLFSQKSAISRMIPDDQQSPDIILPIHGLRNVKAIDYDPLDKL
IYWVDGRQNIIKRAKDDGTQPFTVMGTPNQSQNPEKQPHDLSIDIFSHTLYWTCEATNTV
NVHRLNGEQIGIVLRGDHDKPRAIVVNAERGYMYFTNMQERAPKIERAALDGTEREVLFT
TGLLRPVALVIDNKLGKLFWVDADLKRIESCDLSGANRVTLLDSNILQPMGLTVLGNHLY
WIDRQQQMIERIEKTNGYKRARIQGRIAHLSGIHAVEEIDMVEFSAHPCSRDNGGCSHIC
IAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFTCATGEIDCIPMAWRCDGFSECDD
KSDEANCPVCSADQFQCQKGQCIDRRLRCNGEIDCQDKSDEADCETICHPNQFRCASGQC
VIMKQQCDSFSDCIDGSNELACAKIKPSLDDSQPHSSAIWPVIGIILSIFILGGMYFVCQ
RVVCQRYAGPNGPFPHEYVSGTPHVPLNFIAPGSSQHGTFTGISCGKSMISSMSLMGGSS
GAPLYDRNHVTGASSSSSSSTKATFYPQILNPPPSPATDRSLYNTEMFYSSNIPSTTRSY
RPYLIRGIAPPTTPCSTDVCDSDYTTSRWKANKYYIDLNSDSDPYPPPPTPRSQYMSAEE
SCPPSPATERSYFHLYPPPPSPCTDSS
Download sequence
Identical sequences ENSACAP00000014430

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]