SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000017554 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000017554
Domain Number 1 Region: 135-303
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 2.06e-48
Family Eukaryotic proteases 0.00000207
Further Details:      
 
Domain Number 2 Region: 52-156
Classification Level Classification E-value
Superfamily SRCR-like 0.0000000000000615
Family Hepsin, N-terminal domain 0.0000282
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000017554   Gene: ENSACAG00000017828   Transcript: ENSACAT00000017900
Sequence length 304
Comment pep:novel scaffold:AnoCar2.0:GL343276.1:5628:21895:1 gene:ENSACAG00000017828 transcript:ENSACAT00000017900 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAEKEGGLQACHWTPLKVVAVIATGFLFLAGIGAGIWATVVTLVGSEKESLYAVQVSPGD
LRLTIYDENEGKWRLLCSSSHNAQVASLSCEEMGFVRSLSHSVLAADSAGSNGTSGYFCV
DGSRLPYARMLSEALVVCECPTGRFLATLCQDCGRRKLSVERIVGGQDASLGKWPWQVSL
RYDGTHLCGGSVISAEWVITAAHCFPERNRVVSRWRVFAGAVSQSSAKGLQVGVTSIVYH
GGYHPFQDPNSEENSNDIALMHLAAPLSFNEFIQPVCLPALGQPLVDGKICTVTGWGNTQ
YYGK
Download sequence
Identical sequences ENSACAP00000017554

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]