SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSACAP00000018932 from Anolis carolinensis 69_2.0

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSACAP00000018932
Domain Number 1 Region: 322-517
Classification Level Classification E-value
Superfamily Hemopexin-like domain 4.84e-60
Family Hemopexin-like domain 0.00000755
Further Details:      
 
Domain Number 2 Region: 107-280
Classification Level Classification E-value
Superfamily Metalloproteases ("zincins"), catalytic domain 1.81e-36
Family Matrix metalloproteases, catalytic domain 0.0000619
Further Details:      
 
Domain Number 3 Region: 24-87
Classification Level Classification E-value
Superfamily PGBD-like 8.79e-16
Family MMP N-terminal domain 0.0096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSACAP00000018932   Gene: ENSACAG00000022415   Transcript: ENSACAT00000023458
Sequence length 575
Comment pep:novel scaffold:AnoCar2.0:GL343238.1:212068:227710:1 gene:ENSACAG00000022415 transcript:ENSACAT00000023458 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LLLFLALPSNANPVPTPTDESGEIVEWLMQYGYLPPSDPITGQLQTWEAVTSAIRVMQHF
AGIAETGIPDDATLSLIRMPRCSLPDIITPFPEKLPLREKGRRKRQKGKKSRSRRSAGSV
WTKRNISWRVKTYPRESHLSRETMRTLMYYALKVWSEATPLNFHEVAATLRTSVEVPRLD
HHDGYPFDPGGMVAHAFFPGDPQRAGNVHFDSSEEWTFRSPDDFGTDLFAVAVHEFGHSL
GLTHSPSKHSIMRPYYQGPVGDPLQYQLHVDDCMEIQNLYGMYSSGSRILHSTEKPEVTS
LLPDLLSLPHDFPALRSGREFPDRCVSSVDAVAQIRGETFFFKGQYFWRLTQSRHLTSLR
PALITGFWRGLPPTLRKVDAAYERHTDHRILFFSGPLYWVFKDNGVEEAYPRPVTDFGLP
QGGIDGAFPWPPDRKTYFFKGDLHWSYDEDTGHMEEGFPFQITPWEQFSTSIDAVLSEND
GTLYVFKGKEYWKSDQHTLQPQPGYPRSIAKDWLDCRGELYPSRTMPTSPASRAELHPDL
RGPQLEVEHCACFCSAFQALPSTLLHCLPVLVLAL
Download sequence
Identical sequences ENSACAP00000018932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]