SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387896863|ref|YP_006327159.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387896863|ref|YP_006327159.1|
Domain Number 1 Region: 2-148
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 5.05e-20
Family N-acetyl transferase, NAT 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387896863|ref|YP_006327159.1|
Sequence length 163
Comment GNAT family acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MSRQYRLATEADAYELLSLTLRAYEPIRKLGINFAAATADKELVLNNIQKNACYVLEEDG
RILATISLRMPWGPNPGPYGVPHIWWFAVDPETGKKGTGSDMLEWLENTVLRDTLKAPFV
SLGTADKHPWLIGMYERKGYVRAGEKDLGKGHITIYLKKQLQD
Download sequence
Identical sequences A0A1D9PFK9 A0A1U3SG46 A0A2D3DKH8 A0A2D3KTX7 I2C1B0
gi|384263959|ref|YP_005419666.1| WP_014416893.1.27005 WP_014416893.1.55877 WP_014416893.1.62871 WP_014416893.1.63713 WP_014416893.1.74118 WP_014416893.1.79354 WP_014416893.1.80415 WP_014416893.1.8397 WP_014416893.1.8895 WP_014416893.1.89464 WP_014416893.1.95227 WP_014416893.1.97992 gi|549696277|ref|YP_008624974.1| gi|387896863|ref|YP_006327159.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]