SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387896919|ref|YP_006327215.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387896919|ref|YP_006327215.1|
Domain Number 1 Region: 8-176
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.18e-41
Family N-acetyl transferase, NAT 0.00000329
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387896919|ref|YP_006327215.1|
Sequence length 207
Comment ribosomal-protein-serine acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MFSCQIREHLTIRLLAKEDTDELYSVMKRNQNHLSEWLSWAEELADIDTYRDVIIPEWRY
KYAEENGFDAGIFVKGRFCGMISIHNVDTANQKAEIGYWLDREHEGFGIITASCRAVITH
AFQDLGLNRIMISAAEKNTKSRAVAERLGFQKEGLTREGIFVQGAYHDTVTYSMLKREWS
EDRQKSTFLGLNVSPMWKSNSGDVKKE
Download sequence
Identical sequences A0A142FBA9 A0A2I5Q0R1 I2C1G6
WP_014416932.1.100906 WP_014416932.1.46424 WP_014416932.1.55877 WP_014416932.1.66574 WP_014416932.1.74118 WP_014416932.1.79354 WP_014416932.1.8147 WP_014416932.1.89464 WP_014416932.1.97992 gi|387896919|ref|YP_006327215.1| gi|384264011|ref|YP_005419718.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]