SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387897104|ref|YP_006327400.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387897104|ref|YP_006327400.1|
Domain Number 1 Region: 7-149
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.32e-35
Family N-acetyl transferase, NAT 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387897104|ref|YP_006327400.1|
Sequence length 151
Comment ribosomal-protein-alanine N-acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MKTKTAIRSMRPEDIDQIYEIETASFTSPWTKDSFYHELLENPYAHYLVIEKDGCLAGYC
GIWIIIDDAQITNIAIKPEYRGQSLGEALFRSAIELCREKKARRLSLEVRVSNHPAQSLY
KKFGLQAGGIRKQYYTDNGEDALLMWVTLHE
Download sequence
Identical sequences A0A0D7XMD1 A0A0U0D894 A0A142FBM3 A0A1D9PG64 A0A1N7HG31 A0A1U3TE27 A0A1W6HFT3 A0A2D3DLT8 A0A2D3KUL2 A7Z1Z7 I2C201 I2HN41 S6FCL6
gi|556556363|ref|YP_008725898.1| gi|549696503|ref|YP_008625200.1| WP_003155993.1.10011 WP_003155993.1.100906 WP_003155993.1.101182 WP_003155993.1.101474 WP_003155993.1.10180 WP_003155993.1.10479 WP_003155993.1.10853 WP_003155993.1.11256 WP_003155993.1.13676 WP_003155993.1.14108 WP_003155993.1.16623 WP_003155993.1.17514 WP_003155993.1.17976 WP_003155993.1.18446 WP_003155993.1.211 WP_003155993.1.21189 WP_003155993.1.21864 WP_003155993.1.22860 WP_003155993.1.23363 WP_003155993.1.23850 WP_003155993.1.24042 WP_003155993.1.24336 WP_003155993.1.26408 WP_003155993.1.27005 WP_003155993.1.27811 WP_003155993.1.27978 WP_003155993.1.29703 WP_003155993.1.3071 WP_003155993.1.30991 WP_003155993.1.3136 WP_003155993.1.31728 WP_003155993.1.32802 WP_003155993.1.34580 WP_003155993.1.35373 WP_003155993.1.35817 WP_003155993.1.36989 WP_003155993.1.37381 WP_003155993.1.37657 WP_003155993.1.39952 WP_003155993.1.4124 WP_003155993.1.41474 WP_003155993.1.42579 WP_003155993.1.44318 WP_003155993.1.44634 WP_003155993.1.45361 WP_003155993.1.45980 WP_003155993.1.46424 WP_003155993.1.46685 WP_003155993.1.48095 WP_003155993.1.4883 WP_003155993.1.48909 WP_003155993.1.52667 WP_003155993.1.52720 WP_003155993.1.52960 WP_003155993.1.53225 WP_003155993.1.53492 WP_003155993.1.53921 WP_003155993.1.53942 WP_003155993.1.55373 WP_003155993.1.55877 WP_003155993.1.55915 WP_003155993.1.55959 WP_003155993.1.57138 WP_003155993.1.57234 WP_003155993.1.57257 WP_003155993.1.5788 WP_003155993.1.58329 WP_003155993.1.58623 WP_003155993.1.61048 WP_003155993.1.61124 WP_003155993.1.61265 WP_003155993.1.61335 WP_003155993.1.62170 WP_003155993.1.62742 WP_003155993.1.62871 WP_003155993.1.62879 WP_003155993.1.63713 WP_003155993.1.6586 WP_003155993.1.66543 WP_003155993.1.66574 WP_003155993.1.67719 WP_003155993.1.68293 WP_003155993.1.68714 WP_003155993.1.6973 WP_003155993.1.71749 WP_003155993.1.72983 WP_003155993.1.72986 WP_003155993.1.7364 WP_003155993.1.74118 WP_003155993.1.75310 WP_003155993.1.76774 WP_003155993.1.77593 WP_003155993.1.78242 WP_003155993.1.78914 WP_003155993.1.79354 WP_003155993.1.80280 WP_003155993.1.80415 WP_003155993.1.80671 WP_003155993.1.80690 WP_003155993.1.8147 WP_003155993.1.82532 WP_003155993.1.83568 WP_003155993.1.8397 WP_003155993.1.85402 WP_003155993.1.85444 WP_003155993.1.86493 WP_003155993.1.87529 WP_003155993.1.8895 WP_003155993.1.89039 WP_003155993.1.89464 WP_003155993.1.89937 WP_003155993.1.90093 WP_003155993.1.92062 WP_003155993.1.92694 WP_003155993.1.95227 WP_003155993.1.96909 WP_003155993.1.97374 WP_003155993.1.97917 WP_003155993.1.97992 WP_003155993.1.98151 WP_003155993.1.98556 gi|530568382|ref|YP_008411597.1| gi|530613359|ref|YP_008420020.1| gi|568176296|ref|YP_008949003.1| gi|384264182|ref|YP_005419889.1| gi|429504102|ref|YP_007185286.1| gi|451348053|ref|YP_007446684.1| gi|154685093|ref|YP_001420254.1| gi|452854603|ref|YP_007496286.1| gi|387897104|ref|YP_006327400.1| 326423.RBAM_006380

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]