SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387897394|ref|YP_006327690.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387897394|ref|YP_006327690.1|
Domain Number 1 Region: 84-201
Classification Level Classification E-value
Superfamily PheT/TilS domain 0.000000262
Family B3/B4 domain of PheRS, PheT 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387897394|ref|YP_006327690.1|
Sequence length 207
Comment hypothetical protein MUS_0923 [Bacillus amyloliquefaciens Y2]
Sequence
MNISLDPLIAERVPGIKAAAVLYEQIEVGPAPQMLKGRLRLFQESLYFDYADGGIEEQPF
VKEWARIMEQLSPAFSGQKTPMELMLGDISRERFIESVNSAHDTILFFSLKYSLPIMAYD
AAEIDELISITIGEKESVLSFSGPDGVFGDFTGHINTRSVTPGTKKMLQLIFFPPSFHAD
AADELLSSLTKMFEQIHGGTHTVSWLS
Download sequence
Identical sequences A0A1U3RRU0 A0A2I5Q201 I2C2U1
WP_014417262.1.55877 WP_014417262.1.79354 WP_014417262.1.89464 WP_014417262.1.97992 gi|384264454|ref|YP_005420161.1| gi|387897394|ref|YP_006327690.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]