SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387897596|ref|YP_006327892.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387897596|ref|YP_006327892.1|
Domain Number 1 Region: 1-145
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 4.56e-18
Family N-acetyl transferase, NAT 0.00000761
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387897596|ref|YP_006327892.1|
Sequence length 146
Comment acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MVEVKPITAEDTYAIRHSVLRPHQTIEDCKYDQDSVKGAFHLGGFYDGTLISIASFYPQN
QQALQAAPAYQLRGMATLEEYRTQKAGSTLIAYAERKLADMGAALVWCNARCHVKGYYEK
LGWKSTGSPFDIPGIGPHVIMYKELA
Download sequence
Identical sequences A0A0U0BVJ9 A0A142FCS8 A0A1D9PHS1 A0A1U3SNH2 A0A2D3DLZ2 A0A2D3KVW8 A0A2H6MIU5 I2C3E3 I2HPH6 S6FIN7
gi|530568842|ref|YP_008412057.1| WP_007409151.1.10011 WP_007409151.1.100906 WP_007409151.1.101182 WP_007409151.1.10180 WP_007409151.1.10853 WP_007409151.1.13676 WP_007409151.1.14108 WP_007409151.1.16623 WP_007409151.1.17976 WP_007409151.1.211 WP_007409151.1.21864 WP_007409151.1.23850 WP_007409151.1.24336 WP_007409151.1.27005 WP_007409151.1.29703 WP_007409151.1.3071 WP_007409151.1.34580 WP_007409151.1.34883 WP_007409151.1.35817 WP_007409151.1.37381 WP_007409151.1.39952 WP_007409151.1.42579 WP_007409151.1.46424 WP_007409151.1.48095 WP_007409151.1.4883 WP_007409151.1.48909 WP_007409151.1.49114 WP_007409151.1.52720 WP_007409151.1.53225 WP_007409151.1.53492 WP_007409151.1.53921 WP_007409151.1.53942 WP_007409151.1.55877 WP_007409151.1.55915 WP_007409151.1.55959 WP_007409151.1.58329 WP_007409151.1.58623 WP_007409151.1.61124 WP_007409151.1.61562 WP_007409151.1.62871 WP_007409151.1.63713 WP_007409151.1.66574 WP_007409151.1.67719 WP_007409151.1.68293 WP_007409151.1.68714 WP_007409151.1.6973 WP_007409151.1.71749 WP_007409151.1.72986 WP_007409151.1.74118 WP_007409151.1.75310 WP_007409151.1.76774 WP_007409151.1.79354 WP_007409151.1.80415 WP_007409151.1.8147 WP_007409151.1.83568 WP_007409151.1.8397 WP_007409151.1.85444 WP_007409151.1.8895 WP_007409151.1.89039 WP_007409151.1.89464 WP_007409151.1.89937 WP_007409151.1.90093 WP_007409151.1.92062 WP_007409151.1.93013 WP_007409151.1.93153 WP_007409151.1.95227 WP_007409151.1.96909 WP_007409151.1.97917 WP_007409151.1.97992 WP_007409151.1.98151 gi|384264638|ref|YP_005420345.1| gi|452855038|ref|YP_007496721.1| gi|387897596|ref|YP_006327892.1| gi|549698639|ref|YP_008627336.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]