SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387897648|ref|YP_006327944.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387897648|ref|YP_006327944.1|
Domain Number 1 Region: 47-114
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.000000505
Family N-acetyl transferase, NAT 0.017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387897648|ref|YP_006327944.1|
Sequence length 192
Comment hypothetical protein MUS_1192 [Bacillus amyloliquefaciens Y2]
Sequence
MNWYEKLSEYFPIEEMKSKAHMEALLKEQSDVYHKEEGQYHVLMYAEFDSFIFIDYLFVS
KKSRGQGLGSKLIGRLKKKNKPILLEVEPVDEDDTDTQKRLRFYQREHFKHAQSIGYRRR
SLATNEVNKMEILYWSPKTESEEEMFEAMKQTYENIHTYKDEKWYGESYEKTDEVLKVID
EKKRKNIFDQLS
Download sequence
Identical sequences A0A0D7XM23 A0A142FCX4 A0A1N7D265 A0A1U3SW02 A0A235BHA0 A0A2D3DMK9 A0A2D3KW11 A7Z3D7 I2C3J5 I2HPM9 S6G1G5
gi|429504628|ref|YP_007185812.1| gi|387897648|ref|YP_006327944.1| gi|530613857|ref|YP_008420518.1| gi|154685583|ref|YP_001420744.1| gi|384264686|ref|YP_005420393.1| gi|530568891|ref|YP_008412106.1| WP_007409110.1.10011 WP_007409110.1.100906 WP_007409110.1.10180 WP_007409110.1.10479 WP_007409110.1.13676 WP_007409110.1.14108 WP_007409110.1.16623 WP_007409110.1.17514 WP_007409110.1.17976 WP_007409110.1.18446 WP_007409110.1.211 WP_007409110.1.21189 WP_007409110.1.22860 WP_007409110.1.23850 WP_007409110.1.27005 WP_007409110.1.29703 WP_007409110.1.3136 WP_007409110.1.34580 WP_007409110.1.37381 WP_007409110.1.37657 WP_007409110.1.39952 WP_007409110.1.42579 WP_007409110.1.44318 WP_007409110.1.46424 WP_007409110.1.48095 WP_007409110.1.52720 WP_007409110.1.52960 WP_007409110.1.53225 WP_007409110.1.53921 WP_007409110.1.54902 WP_007409110.1.55877 WP_007409110.1.55915 WP_007409110.1.55959 WP_007409110.1.58329 WP_007409110.1.61048 WP_007409110.1.61562 WP_007409110.1.62170 WP_007409110.1.63713 WP_007409110.1.6586 WP_007409110.1.66543 WP_007409110.1.66574 WP_007409110.1.67719 WP_007409110.1.68293 WP_007409110.1.68714 WP_007409110.1.6973 WP_007409110.1.71749 WP_007409110.1.73139 WP_007409110.1.74118 WP_007409110.1.76774 WP_007409110.1.78914 WP_007409110.1.79354 WP_007409110.1.80280 WP_007409110.1.80415 WP_007409110.1.80671 WP_007409110.1.8147 WP_007409110.1.83568 WP_007409110.1.8397 WP_007409110.1.85402 WP_007409110.1.85444 WP_007409110.1.86493 WP_007409110.1.87529 WP_007409110.1.8895 WP_007409110.1.89039 WP_007409110.1.89464 WP_007409110.1.89937 WP_007409110.1.90093 WP_007409110.1.92062 WP_007409110.1.92694 WP_007409110.1.93013 WP_007409110.1.95227 WP_007409110.1.96909 WP_007409110.1.97992 WP_007409110.1.98151 gi|452855086|ref|YP_007496769.1| gi|556556895|ref|YP_008726430.1| gi|549698590|ref|YP_008627287.1| 326423.RBAM_011490

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]