SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387897690|ref|YP_006327986.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387897690|ref|YP_006327986.1|
Domain Number 1 Region: 4-140
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.34e-35
Family N-acetyl transferase, NAT 0.00000181
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387897690|ref|YP_006327986.1|
Sequence length 143
Comment acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MESIIAKTEKQLNDAFFVRKEVFVKEQHVPEEEEIDQFEDTSEHIVIYDGGQPVGAGRWR
MKDGHGKLERICVMKSHRSLGVGAIIMQALEKAAAAKGADSFLLHAQTQAVPFYEKQGYR
VTSGEEFLDAGIPHLEMIKEHKR
Download sequence
Identical sequences A0A2D3KW42 A0A2I5Q2R9 I2C3N7
gi|384264727|ref|YP_005420434.1| gi|387897690|ref|YP_006327986.1| gi|549698548|ref|YP_008627245.1| WP_014417444.1.100906 WP_014417444.1.27005 WP_014417444.1.46424 WP_014417444.1.55877 WP_014417444.1.55915 WP_014417444.1.63713 WP_014417444.1.66574 WP_014417444.1.79354 WP_014417444.1.8895 WP_014417444.1.89464 WP_014417444.1.97992

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]