SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387897827|ref|YP_006328123.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387897827|ref|YP_006328123.1|
Domain Number 1 Region: 9-155
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 1.3e-36
Family N-acetyl transferase, NAT 0.0041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387897827|ref|YP_006328123.1|
Sequence length 181
Comment ribosomal-protein-alanine N-acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MMEHKSSGTILTTGRIRLRTMRDDDEENLYGLFTDREVMKYYPSLKSRRETREWIAWNKR
LAAGYGISLWIAEDKETGAFLGQCGIVPQTVNGNTLMEIGYMFARCRWGCGYATEAANAC
LDYGFHMQQYGRIAALIDPENAASVRVAEKIGMVPGETVTKWERQLTVFDITSDVERFGE
M
Download sequence
Identical sequences A0A2I5Q320 I2C424
gi|384264855|ref|YP_005420562.1| WP_014417544.1.55877 WP_014417544.1.79354 WP_014417544.1.89464 WP_014417544.1.97992 gi|387897827|ref|YP_006328123.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]