SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387898007|ref|YP_006328303.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387898007|ref|YP_006328303.1|
Domain Number 1 Region: 2-150
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.00000000000044
Family N-acetyl transferase, NAT 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387898007|ref|YP_006328303.1|
Sequence length 150
Comment hypothetical protein MUS_1566 [Bacillus amyloliquefaciens Y2]
Sequence
MLTGRDFEEEDLGFLEQLAASHPVWKSEEFGTKNAAEFMLAYSMYNGTWLVWEIDGAPAA
VSFHLEWAPSNGKPWLGTVAVAPEAKEKGIGRAVIEEIAGRLRGEHKAMFSAVPLDRQEW
VLFLSQCGFEQLKLEKDDREKTYMIMVKPL
Download sequence
Identical sequences A0A1U3X2N5 A0A235BI20 A0A2D3KWV6 A0A2H6MI51 I2C4K4
WP_014417654.1.100906 WP_014417654.1.27005 WP_014417654.1.46424 WP_014417654.1.55877 WP_014417654.1.55915 WP_014417654.1.63713 WP_014417654.1.66574 WP_014417654.1.79354 WP_014417654.1.8397 WP_014417654.1.8895 WP_014417654.1.89464 WP_014417654.1.93013 WP_014417654.1.97992 gi|549698243|ref|YP_008626940.1| gi|387898007|ref|YP_006328303.1| gi|384265022|ref|YP_005420729.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]