SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387898490|ref|YP_006328786.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387898490|ref|YP_006328786.1|
Domain Number 1 Region: 1-173
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 9.87e-51
Family N-acetyl transferase, NAT 0.0014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) gi|387898490|ref|YP_006328786.1|
Sequence length 179
Comment ribosomal-protein-alanine acetyltransferase [Bacillus amyloliquefaciens Y2]
Sequence
MLPVIETDRLILREVEKKDTKQIFACFSNTNVTRYYGLEPFDSMEQAEKMIGWFKDQYHD
KKGMRWGIERKDAKGIIGTIGFNSWVPKHKRAEIGYEIHPNYWRNGYAFEALENVLSFGF
EKLGLHRIGAVVFIENAASHQLLIKAGFQSEGILRRYMYQNGLLHDTRVYSILNEIVNE
Download sequence
Identical sequences A0A1U3UU34 A0A235BK41 A0A2D3KXQ3 I2C5Y7
gi|387898490|ref|YP_006328786.1| WP_014418009.1.100906 WP_014418009.1.27005 WP_014418009.1.46424 WP_014418009.1.55877 WP_014418009.1.55915 WP_014418009.1.63713 WP_014418009.1.66574 WP_014418009.1.74118 WP_014418009.1.79354 WP_014418009.1.8397 WP_014418009.1.8895 WP_014418009.1.89464 WP_014418009.1.97992 gi|549697931|ref|YP_008626628.1| gi|384265511|ref|YP_005421218.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]