SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387898637|ref|YP_006328933.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387898637|ref|YP_006328933.1|
Domain Number 1 Region: 79-151
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000106
Family N-acetyl transferase, NAT 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|387898637|ref|YP_006328933.1|
Sequence length 167
Comment hypothetical protein MUS_2262 [Bacillus amyloliquefaciens Y2]
Sequence
MILFTAEERDQKELEKELHKLEFQIFRMRENLIDVSKDARVLGIDQSNNDDWIIVSSIDD
GQTCKIMLTDCESAYRGRGCFSLIASYYDNAIHIGDIKGPPNHGYGSICMKFLKHIAREQ
NIPKVTGDIAKRDWDHVDRLVHFYEKHHFDVWIDNDTQSGGIKWVDL
Download sequence
Identical sequences I2C6D4
gi|387898637|ref|YP_006328933.1| gi|384265644|ref|YP_005421351.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]