SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|387898932|ref|YP_006329228.1| from Bacillus amyloliquefaciens Y2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|387898932|ref|YP_006329228.1|
Domain Number 1 Region: 5-96
Classification Level Classification E-value
Superfamily Acyl-CoA N-acyltransferases (Nat) 0.0000000000000135
Family N-acetyl transferase, NAT 0.014
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|387898932|ref|YP_006329228.1|
Sequence length 124
Comment riboflavin biosynthesis RibT protein [Bacillus amyloliquefaciens Y2]
Sequence
MLIRYKKSFEKIAMGLLSFMPNEKDLKQLQQTIKDYETDTGRQLFLWKEDEDIVGAIGVE
KKDSEVEIRHISVNPSHRHQGIGKQMMDALKRLFKTEALVPNELTQSFFERCQHQKDQDI
SYNN
Download sequence
Identical sequences A0A0U0D177 A0A0X8KJQ0 A0A142F617 A0A1D9PL03 A0A1U3V4S6 A0A1W6HK85 A0A268DR07 A0A2D3DQC9 A0A2D3KZ38 A0A2H6MEZ8 A7Z673 I2C779 S6FT60
gi|568177864|ref|YP_008950639.1| gi|530614828|ref|YP_008421489.1| gi|549697394|ref|YP_008626091.1| gi|384265919|ref|YP_005421626.1| gi|387898932|ref|YP_006329228.1| gi|375362838|ref|YP_005130877.1| WP_003153373.1.10011 WP_003153373.1.100906 WP_003153373.1.101182 WP_003153373.1.101474 WP_003153373.1.10180 WP_003153373.1.10479 WP_003153373.1.10853 WP_003153373.1.11256 WP_003153373.1.11310 WP_003153373.1.13676 WP_003153373.1.14108 WP_003153373.1.16623 WP_003153373.1.17514 WP_003153373.1.211 WP_003153373.1.21261 WP_003153373.1.21864 WP_003153373.1.23363 WP_003153373.1.23850 WP_003153373.1.24042 WP_003153373.1.24336 WP_003153373.1.26408 WP_003153373.1.27005 WP_003153373.1.27811 WP_003153373.1.27978 WP_003153373.1.29703 WP_003153373.1.3071 WP_003153373.1.30991 WP_003153373.1.31728 WP_003153373.1.32802 WP_003153373.1.34580 WP_003153373.1.34883 WP_003153373.1.35373 WP_003153373.1.35817 WP_003153373.1.36001 WP_003153373.1.37381 WP_003153373.1.37657 WP_003153373.1.39952 WP_003153373.1.4124 WP_003153373.1.41474 WP_003153373.1.42579 WP_003153373.1.44318 WP_003153373.1.44634 WP_003153373.1.45361 WP_003153373.1.45591 WP_003153373.1.45935 WP_003153373.1.45980 WP_003153373.1.46424 WP_003153373.1.46685 WP_003153373.1.48095 WP_003153373.1.4883 WP_003153373.1.48909 WP_003153373.1.49114 WP_003153373.1.52667 WP_003153373.1.52720 WP_003153373.1.52960 WP_003153373.1.53225 WP_003153373.1.53492 WP_003153373.1.53921 WP_003153373.1.53942 WP_003153373.1.54902 WP_003153373.1.55276 WP_003153373.1.55373 WP_003153373.1.55877 WP_003153373.1.55915 WP_003153373.1.55959 WP_003153373.1.57234 WP_003153373.1.57257 WP_003153373.1.58329 WP_003153373.1.58623 WP_003153373.1.61124 WP_003153373.1.61265 WP_003153373.1.61335 WP_003153373.1.62170 WP_003153373.1.62742 WP_003153373.1.62871 WP_003153373.1.62879 WP_003153373.1.63713 WP_003153373.1.66574 WP_003153373.1.67719 WP_003153373.1.68293 WP_003153373.1.6973 WP_003153373.1.71749 WP_003153373.1.72983 WP_003153373.1.72986 WP_003153373.1.7364 WP_003153373.1.74118 WP_003153373.1.75310 WP_003153373.1.76774 WP_003153373.1.77593 WP_003153373.1.78242 WP_003153373.1.79354 WP_003153373.1.80280 WP_003153373.1.80415 WP_003153373.1.80690 WP_003153373.1.8147 WP_003153373.1.82532 WP_003153373.1.83568 WP_003153373.1.8397 WP_003153373.1.85444 WP_003153373.1.86493 WP_003153373.1.8895 WP_003153373.1.89464 WP_003153373.1.89937 WP_003153373.1.90093 WP_003153373.1.92062 WP_003153373.1.93013 WP_003153373.1.93153 WP_003153373.1.94746 WP_003153373.1.95227 WP_003153373.1.96909 WP_003153373.1.97374 WP_003153373.1.97917 WP_003153373.1.97992 WP_003153373.1.98151 WP_003153373.1.98556 gi|452856081|ref|YP_007497764.1| gi|556557950|ref|YP_008727485.1| gi|530570042|ref|YP_008413257.1| 326423.RBAM_021380 gi|451346490|ref|YP_007445121.1| gi|154686569|ref|YP_001421730.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]